CAZyme Information: EGD85707.2

Basic Information

• Species: Trichophyton rubrum
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton rubrum
• CAZyme ID: EGD85707.2
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
684		77681.20	8.5172

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TrubrumCBS118892	8713	559305	97	8616

• Gene Location: location=GG700649:1128856-1130967(+)

Full Sequence      

MYIQGTYFFDVHPPFAKLLFALVGWLVGFDGKFLFENIGDSYTDNKVPYVALRALPAMLG
SLTVPVVFLIMWESGYSLPACVLSAGLLLFDNAHIGEDRLILLDATLVISMALSVLCYIK
FHKNRHQPFSRKWWKWMLMTGIALSCVISTKYVGVFTFVTIGSAVLIDLWGLLDVNRRQG
KLSLFEFGTHFAARAFGLIIVPFFIYLFWFQVHFAILTKSGPGDDFMSPEFQASLSDNPM
FAQSKGVEYYDVLTFRHKDTKVYLHSHPDRYPLRYDDGRVSSQGQQVTGYPHNDTNNHWE
ILPQVAFASDNRTGHKVRNGHIVQLRHVATNTFLLSHDVASPSYPTNQEFTTISPEEAAG
NRHNDTLFEIQVPKGKADEEFRTRSSLFNLIHFPSKVAMWTHTNPLPDWGYKQAEINGNK
NSKEPSNLWYAEDIPSLAPDSPRSHQEPRKVQPMRFLKKYLELQAAMFHHNNALTSSHPY
ASEPFQWPFLLRGVSFWTKNDTREQIYFLGNPVGWWLCSSLLAVFVGILGADQLALRRGI
DALEEIWGPGTRHRLYNSTGFFFLCWAAHYFPFYLMGRQRFLHHYLPSHVASVLVTGALV
EFIFNIDPAGLSEDFVASKPGRGPLKIKHTRQSLLAIWAATIAILGATIWGFGFFAPLTY
GTPGLDVAGINARKWLSYDLHFAK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	2	214	4.2e-54	0.8475336322869955

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	2	684	62	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
406576	PMT_4TMC	7.60e-80	458	677	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
396786	PMT	2.51e-67	1	218	34	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
397103	MIR	1.72e-19	259	429	7	183	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	1.22e-09	247	303	4	56	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW29154.1|GT39	0.0	2	684	84	775
QMW41228.1|GT39	0.0	2	684	84	775
QRD85448.1|GT39	0.0	2	684	84	775
UDD58942.1|GT39	0.0	2	684	84	775
EAA64589.1|GT39	0.0	2	684	82	773

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	1.33e-98	2	677	88	725	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	7.96e-85	2	677	103	749	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X23|PMT4_CANAL	9.63e-235	2	684	86	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|P46971|PMT4_YEAST	6.19e-227	2	684	91	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|O42933|PMT4_SCHPO	2.62e-219	2	676	97	767	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|F1Q8R9|POMT2_DANRE	6.68e-105	2	664	106	735	Protein O-mannosyl-transferase 2 OS=Danio rerio OX=7955 GN=pomt2 PE=1 SV=1
sp|Q8BGQ4|POMT2_MOUSE	6.76e-100	2	664	166	799	Protein O-mannosyl-transferase 2 OS=Mus musculus OX=10090 GN=Pomt2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000008	0.000001

TMHMM  Annotations     

Start	End
7	29
49	71
76	95
100	119
140	162
191	210
507	529
555	577
634	656