CAZyme Information: EGD85508.1

Basic Information

• Species: Trichophyton rubrum
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton rubrum
• CAZyme ID: EGD85508.1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
512		57378.81	7.2262

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TrubrumCBS118892	8713	559305	97	8616

• Gene Location: location=GG700649:605383-606921(-)

Full Sequence      

MRGLYTAPLAGLFCSIFLLGPVTASTPASSSDKLEERDLNNNNPSDPCECYIVSGEDPGY
FRHHRFYDFRSRGLELAADKEKHPQQHRRNITSRRLPGTGHGGIPVHIPGRVIDFDSKGR
DNEAGGAPDPNADSNEFHPTLAGSRFIEDWDVQNWNREGSALFPIPIKNSHHNVFIVRNS
TERGDETTHMVLRTVRMENHTSTAEVQTHDTDIVHVSLRVRLRLYANSGWFYFPKEKGGN
ISTVTDDAHYFLPTSYWIKGPPVGACAGVFTYYGKSDESDIEILTGDPPNLVRYANQPDW
DPKTDESIPGASDEVEIAVPWTHWGDHRIDWFQDISRWYFNGEPLVSKTYGVPKHPSMLI
LNLWSDGGEWTGNMTVGSSVYMGVEWVEMVYNKTTDVEGAHKKHIRANPGSETEGDEHNK
HEDSESTQHRSDKVPSLQSARRGRPRPKKKQVGKGKIGGRPKNKGTGKGKGKHKGKKPET
KPKPNDKDSQEENCKVVCRVDGVRTQGVPEVI

Enzyme Prediction     

No EC number prediction in EGD85508.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	148	389	3.3e-76	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	2.39e-33	144	390	7	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	1.30e-07	258	387	78	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
225182	BglS	0.002	264	393	132	267	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS53837.1|GH16_22	9.18e-98	48	392	42	360
QSS58825.1|GH16_22	9.18e-98	48	392	42	360
QSS75565.1|GH16_22	1.30e-97	48	392	42	360
CAP95204.1|GH16_22	9.89e-85	48	397	80	418
QQK40468.1|GH16_22	1.96e-83	48	396	40	376

PDB Hits     

EGD85508.1 has no PDB hit.

Swiss-Prot Hits     

EGD85508.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000412	0.999554	CS pos: 24-25. Pr: 0.9792

TMHMM  Annotations     

There is no transmembrane helices in EGD85508.1.