CAZyme Information: EGD84175.1

Basic Information

• Species: Trichophyton rubrum
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Trichophyton; Trichophyton rubrum
• CAZyme ID: EGD84175.1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
611		70433.38	7.8628

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TrubrumCBS118892	8713	559305	97	8616

• Gene Location: location=GG700648:1194143-1196043(+)

Full Sequence      

MKGRRFTLLAGLASLIVLLFIFYAPNSDERPIIPAPNPGISPATAPQQPPPVESFGDENI
NYNNPAGSTGDDLAQHPIERLIQTSREQFRTTHSRQSKTLQQAATEYRRRYGLHPPPHFD
VWLKFAQSRGVQMIDEYDTIYHTLLPFWGVKPKTIRERAREAIGFENALIGLMIRDGNVT
LVDGGGEGEQWKRDAIKGMMATFVKYLPDMDLAFNIHDEPRVVMAHSDLSRLVADGKRMT
ASNGQQQGLQNRWSARPEGLNKGDRIDEVRRTRFNRFAHQPTWTNSRMSCPPDSPARQLE
DEPVDNMSQYSTSPLGFISNTTAFSDICLTPSLRQTFGFFERPNALDIVHDLFPIFSQSK
VSSFQDILYPSPWYWNGNVAYDANQDMDWSVKEDQMYWRGSTTGGFSRAGGWRRQHRQLF
VRNINSLSPTNILEKSLETGRWAVKQIQRNALRSLFNVSFSHVGQCDPEDCEAQKEYFTI
VKPAKQQDAWKFKYLVDIDGNAFSGRYYAFLLSKSLVYKLALFREWHDEWLRPWVHFIPL
SFRGTEHYESVRYFAKEEPGKDEALAIAQDSQKWARKVLRNEDLEVWFFRLLLEYGRVID
DNRERLGFSTG

Enzyme Prediction     

No EC number prediction in EGD84175.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	331	599	2e-78	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	5.99e-21	350	597	28	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	9.02e-09	354	597	108	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA13289.1|GT90	9.93e-269	76	608	56	588
QQK41201.1|GT90	1.03e-268	75	608	58	589
BCR83603.1|GT90	2.02e-268	1	608	1	598
CAP94438.1|GT90	4.71e-265	75	608	59	590
QKX56622.1|GT90	6.17e-264	76	609	354	887

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	7.25e-11	354	599	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	1.35e-09	331	605	95	348	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.36e-54	40	604	111	661	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|A0NDG6|RUMI_ANOGA	3.68e-10	354	605	163	392	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1
sp|Q8T045|RUMI_DROME	3.87e-10	354	599	166	391	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|Q16QY8|RUMI_AEDAE	3.60e-09	354	599	163	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	8.10e-09	331	605	123	376	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.988102	0.011921

TMHMM  Annotations     

Start	End
7	24