CAZyme Information: EFQ36571.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ36571.1
• CAZy Family: GT8
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:E3R0D3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	GG697439|CGC1	37774.32	6.0394

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697439:42246-43337(-)

Full Sequence      

MSTKQALCLLPLLFGLGWSSPTLYPRKGDRAQSSVISTSTTSSLPGGAKATETPTPSNPS
AAPVASGTPSGGNGTKPGGGGKPTLPEGYAKIVFQDDFSTQKAGALPDASKWTFDVGTGY
PGGAANWGTQEIQTYTKDPANIAISESGTLTITPIKSGEAWTSSRIETNAAQDFKCPEGG
KLRMEASIMIPASDPSTQAGIWPAFWSMGSAFRTNVSSWPSVGEIDMLEVSNGVGTVFQT
AHCGVINGGPCKEKTGLSSSAEFPRGEFVKVACEVDRSAGGGFASEKLVWYVNDQPTKTI
TGQQVGDEAFWKNLAQTSKMILLNVAVGGEFPDAKAGSKTPTAQTVGGKDSRMEVKYVAV
YSS

Enzyme Prediction     

No EC number prediction in EFQ36571.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	95	361	8.3e-49	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185691	GH16_Strep_laminarinase_like	6.01e-109	91	362	3	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185693	GH16_laminarinase_like	3.69e-44	94	361	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185694	GH16_CCF	2.12e-14	92	362	1	330	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
185683	Glyco_hydrolase_16	6.53e-14	96	361	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185689	GH16_fungal_KRE6_glucanase	1.61e-06	176	361	76	294	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC90783.1|GH16_3	3.59e-199	1	363	1	365
QBZ55217.1|GH16_3	9.90e-134	85	363	198	476
AAX07660.1|GH16_3	1.99e-90	85	363	104	387
QBZ61307.1|GH16_3	1.99e-90	85	363	104	387
UNI19827.1|GH16_3	4.49e-87	85	361	38	319

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EO3_A	3.15e-69	92	363	12	280	Chain A, 1,3-beta-glucanase [Actinomycetia bacterium]
3DGT_A	1.38e-60	83	362	3	275	The 1.5 A crystal structure of endo-1,3-beta-glucanase from Streptomyces sioyaensis [Streptomyces sioyaensis]
5WUT_A	1.34e-18	91	331	6	212	Crystal structure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.],5WUT_B Crystal structure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.]
5NBO_A	1.67e-13	92	331	36	244	Bacteroides ovatus mixed linkage glucan PUL (MLGUL) GH16 [Bacteroides ovatus],5NBO_B Bacteroides ovatus mixed linkage glucan PUL (MLGUL) GH16 [Bacteroides ovatus],5NBP_A Bacteroides ovatus mixed linkage glucan PUL (MLGUL) GH16 in complex with G4G4G3G Product [Bacteroides ovatus],5NBP_B Bacteroides ovatus mixed linkage glucan PUL (MLGUL) GH16 in complex with G4G4G3G Product [Bacteroides ovatus],6VHO_AAA Chain AAA, Glycosyl hydrolase family 16 [Bacteroides ovatus ATCC 8483],6VHO_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides ovatus ATCC 8483]
3ILN_A	8.01e-13	91	331	6	224	Chain A, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P45798|GUB_RHOMR	1.84e-12	91	331	41	259	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000530	0.999437	CS pos: 19-20. Pr: 0.9668

TMHMM  Annotations     

There is no transmembrane helices in EFQ36571.1.