CAZyme Information: EFQ35915.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ35915.1
• CAZy Family: GT22
• CAZyme Description: Cutinase [Source:UniProtKB/TrEMBL;Acc:E3QYH7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
277		28627.88	5.5292

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697403:74358-75460(-)

Full Sequence      

MRTTTAFAVAGFLTASASAQDSAATCATGIHLIVARGSNEPAGVGRIGSVANGVVASIPG
SQIEAINYPATFDNYSTSVAAGAEAMKIALTQYSSQCPNSKIALLGYSQGAQVVGDTLCG
NTEDFKSGNMDFDFNFTTPVAASVIDHSVIAAILFGDPTHNTSASWNKGTSTHDGLFPRE
NVTACKGYAPKIESYCDTGDIYCDLGNDTTVHGSYFKKYTNEAVEFIVARFNATKSSTNS
TSPTTTSRPVPASGSAPSASAMLMSLAGLSVLVTHLL

Enzyme Prediction     

No EC number prediction in EFQ35915.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	28	230	3.9e-48	0.9788359788359788

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	4.61e-50	26	231	1	173	Cutinase.
369775	PE-PPE	0.008	59	114	1	62	PE-PPE domain. This domain is found C terminal to the PE (pfam00934) and PPE (pfam00823) domains. The secondary structure of this domain is predicted to be a mixture of alpha helices and beta strands.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP67123.1|CE5	8.23e-69	25	249	26	239
CDP24539.1|CE5	8.23e-69	25	249	26	239
VBB73737.1|CE5	6.59e-68	25	233	26	225
AAP57757.1|CE5	1.67e-63	17	237	16	229
QBZ65259.1|CE5	4.76e-60	6	237	4	238

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BS9_A	2.97e-34	30	230	5	205	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	2.97e-34	30	230	5	205	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	4.53e-33	30	230	5	205	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1QOZ_A	2.68e-31	30	227	5	202	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
7CY3_A	9.07e-07	22	230	13	192	Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY3_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY9_A Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9],7CY9_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O59893|AXE2_TALPU	3.08e-33	30	230	32	232	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|Q99034|AXE1_HYPJE	2.93e-32	30	257	36	264	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	5.40e-30	30	233	28	231	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|O06319|CULP4_MYCTU	2.61e-13	6	230	27	225	Phospholipase Culp4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut4 PE=1 SV=3
sp|P9WP43|CULP1_MYCTU	5.44e-12	30	232	38	214	Carboxylesterase Culp1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000288	0.999679	CS pos: 19-20. Pr: 0.9723

TMHMM  Annotations     

There is no transmembrane helices in EFQ35915.1.