CAZyme Information: EFQ35522.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ35522.1
• CAZy Family: GT2
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:E3QXD4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
223	GG697394|CGC1	23085.05	4.4953

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697394:194567-195238(-)

Full Sequence      

MAPRQAQAPAPAPAVPLRIMSLGASVSFGIGSTTGDSYRKDLQDLLVAQGMNVTYVGTKA
NGDFTDNAVEATPGFKIDQIAAAADEAVPLLQPNLVLVDAGTNNCNKGGIIPDAGANVTA
MINNIFAQSPGSTVILTSILANKIAAQDACRVNINAQYADVATQFQQSGAKFALVDMRSP
AAPGLNDLNDTRHPNDGGYVKMANVWATGIQEVISQGFITAPN

Enzyme Prediction     

No EC number prediction in EFQ35522.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	17	209	6.7e-50	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	3.86e-33	17	210	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	3.67e-11	22	199	2	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	8.99e-10	22	207	4	185	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238866	sialate_O-acetylesterase_like2	9.85e-09	86	214	42	168	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
239945	SGNH_hydrolase_like_4	2.37e-05	18	205	2	178	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC73362.1|CE0	2.19e-116	15	222	15	222
AVF19998.1|CE3	6.27e-116	15	223	15	223
QBZ55219.1|CE3	2.02e-85	15	222	35	248
AEO66483.1|CE0	2.36e-53	15	222	41	250
UNI21161.1|CE0	9.80e-52	15	223	44	252

PDB Hits     

EFQ35522.1 has no PDB hit.

Swiss-Prot Hits     

EFQ35522.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000014

TMHMM  Annotations     

There is no transmembrane helices in EFQ35522.1.