CAZyme Information: EFQ35487.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ35487.1
• CAZy Family: GT2
• CAZyme Description: Glycolipid 2-alpha-mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:E3QX99]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489	GG697394|CGC1	55589.90	5.4056

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697394:42563-44114(+)

Full Sequence      

MARRSRLVLPSWCALIFTILLNLLQVPSACSVPLYVRSPSPRAAFVALVSENQLDQMVES
VTQLEQRFNSKYRYDWVFFSFEELSEDFKDATSNATTGTVTYNLITQQHCSVSRQAEMGR
SNAVDTGTAQTQVSHHSRRWSAGPFAREKRLQAYDWFWMVEPGTQFMCDINLDIFRLMRD
HGITYGFNEMPSQDEENSKQLWQSTKYFMAKHPELVRPAADITWILTDGGNLSEPSFSSE
YHVGQKEEVHIDQDLDFRTQACRRGGSENEGSVCPGVSHEADDEQYNSHSTIDANVPRLA
SNYEECAADTRIEVGSLDHFRSLQHTSYFDYLDNAGEFYDGNPGDLNVHSLSASMFLPRE
KLWLFGDMAGEMNSLHSRPLLSRPVSHSDVVHDSTSLADILGSSWFHSPDGSHLSIIHRL
WANMASGIARQNGFPAAQTGHTALDERNFKIYKPERYPVDVKLGWYSLEDTWRSWAIDRA
KQLLALLGW

Enzyme Prediction     

No EC number prediction in EFQ35487.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT15	42	369	5.1e-63	0.9706959706959707

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227353	KTR1	1.96e-53	33	367	70	344	Mannosyltransferase [Carbohydrate transport and metabolism].
396385	Glyco_transf_15	2.17e-53	33	369	35	308	Glycolipid 2-alpha-mannosyltransferase. This is a family of alpha-1,2 mannosyl-transferases involved in N-linked and O-linked glycosylation of proteins. Some of the enzymes in this family have been shown to be involved in O- and N-linked glycan modifications in the Golgi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC73429.1|GT15	2.22e-192	1	489	50	532
QPC61333.1|GT15	5.45e-61	31	469	28	462
UKZ61490.1|GT15	1.12e-60	41	451	46	479
CZS83948.1|GT15	1.52e-59	42	469	38	461
QPC78685.1|GT15	3.97e-59	42	465	38	456

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7BOO_A	5.99e-36	33	368	59	339	Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOP_A Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163]
1S4N_A	1.97e-35	37	368	23	290	Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4N_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4O_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4O_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4P_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae],1S4P_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae]
5A07_A	1.14e-21	23	389	80	393	X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A07_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A08_A X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C],5A08_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P27810|KTR1_YEAST	4.38e-42	39	380	69	347	Alpha-1,2 mannosyltransferase KTR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR1 PE=1 SV=1
sp|Q00310|MNT1_CANAL	1.12e-37	35	368	103	373	Glycolipid 2-alpha-mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNT1 PE=3 SV=1
sp|P46592|MNT2_CANAL	4.14e-35	36	378	135	413	Glycolipid 2-alpha-mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNT2 PE=3 SV=4
sp|O60160|OMH1_SCHPO	3.13e-34	43	368	72	334	O-glycoside alpha-1,2-mannosyltransferase omh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=omh1 PE=3 SV=1
sp|P27809|KRE2_YEAST	5.40e-34	37	368	117	384	Glycolipid 2-alpha-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000374	0.999601	CS pos: 31-32. Pr: 0.8896

TMHMM  Annotations     

Start	End
7	29