CAZyme Information: EFQ35385.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ35385.1
• CAZy Family: PL1
• CAZyme Description: Glucan 1,3-beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:E3QWZ7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426		43765.05	4.5163

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697392:96771-98051(-)

Full Sequence      

MKASISLAALTALAATAEAQNWLGFNSGATKDDRSAKFKADFEAEFKTAQNLVGAPGNFN
AVRLYTNIQAYSTDDPIQAFEAAIETQTHILLGVWASGTDNIDKEISALKKAVTQYGTKL
TDLIIGASIGSEDLYRNSVTGVTNKSGVGADPETIVGFINDFKTAFKDTPLSKVSIGHVD
TWDVWGNATNKPVLDAIDWVGVDEYPYYENGKGNSIENAGSLFDKAYAATVATAGGKPVW
VTETGWPVTGENWDQAVPSPENAKIYWDEVGCRKLFNKVPTFWYNLRDSNPDNTMKFAIT
ENLSTTPQFNLTCPTTFSTPTGTSSASVSGTATAKPSSTSGASSGSKSGGSSNDTVSTGS
PSPSGASGSGSGSSSGSGSSGSGSGSGSGSGAGASTPSTVASSASGLQLLTTGTLAAVIG
ALALLY

Enzyme Prediction     

No EC number prediction in EFQ35385.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	9.32e-24	23	272	46	267	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	4.60e-09	76	290	55	283	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAQ16224.1|GH17	1.87e-233	1	315	1	315
UQC77015.1|GH17	5.17e-209	1	321	1	321
UNI15929.1|GH17	1.17e-182	4	319	5	319
ATY67306.1|GH17	5.56e-177	4	319	5	320
UPL00499.1|GH17	2.96e-176	1	313	1	312

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	4.05e-19	58	288	58	268	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QH21|EGLC_ASPNC	3.55e-101	7	313	6	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=eglC PE=3 SV=2
sp|Q4WG16|EGLC_ASPFU	2.94e-99	7	313	6	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	3.32e-99	7	313	6	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	3.73e-98	7	313	6	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q0C7P6|EGLC_ASPTN	2.13e-97	7	313	6	311	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001824	0.998124	CS pos: 19-20. Pr: 0.9631

TMHMM  Annotations     

There is no transmembrane helices in EFQ35385.1.