CAZyme Information: EFQ35166.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ35166.1
• CAZy Family: GT1
• CAZyme Description: Glycosyl Hydrolase Family 88 [Source:UniProtKB/TrEMBL;Acc:E3QWC8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397		44138.08	4.4608

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697389:39203-40482(-)

Full Sequence      

MKPVSALLFLASGAAAATVDEPLAGRTIDSWIRNNNEAQRAGWYGRAALYTGVEAVYELT
RNETLLAWYRSVIDGPVVAEDGSIPGFDPAHYSLDDYRIGRNILYWHQRTTTGGGDAGGA
ESKYRAAADAIRAMLDRHPRTPSGGFWHRDPVYRNQMWLDGIYMADTFYAHYTSLFDAAN
ATAWDDIVLQWDLIEAAVRDPDTGLLFHGFDEGREAVWADAETGASPLVWNRAVGWYFMS
LVEILDLFPRDHPGHARLLGYYTTLAAALRRAQDPDSHGWWLVMNGPYPGREGNYLESSA
AAMFTWGWLAGLRLGYLDEATYLEPATKAYTHLVTDFVTENGNGTVTFTDTVQVGSLNSD
ASFEYYIGIPVVDDDTRGVGPFLLAAYEWELRNNITA

Enzyme Prediction     

No EC number prediction in EFQ35166.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	37	390	1.8e-94	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	3.20e-59	17	391	9	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	7.79e-56	29	390	7	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ53569.1|GH105	3.80e-189	1	397	6	405
EAA61616.1|GH105	7.69e-186	29	393	24	380
CAP97462.1|GH105	1.64e-182	1	392	1	378
UPK90791.1|GH105	1.05e-181	14	394	12	383
CCT69602.1|GH105	1.47e-173	23	393	20	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	2.63e-73	29	390	10	359	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	5.89e-44	18	390	15	365	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.50e-43	18	390	5	355	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	9.02e-08	139	334	146	329	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4Q88_A	1.12e-07	230	388	208	353	Chain A, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	3.03e-43	18	390	15	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	7.52e-24	185	388	20	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	7.52e-24	185	388	20	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.009790	0.990183	CS pos: 16-17. Pr: 0.9489

TMHMM  Annotations     

There is no transmembrane helices in EFQ35166.1.