CAZyme Information: EFQ34849.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ34849.1
• CAZy Family: GH78
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
550		62464.79	4.8195

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697384:301739-303391(+)

Full Sequence      

MRLTYPDIVRRLYDLERLAEPPAPGERGGCMSSYDRRSRYDPETDRYIDWDANDDGGGVI
REEGQWVVAFEQRGPGVIWRSWSAMPDVGRIQIFIDDEQDGEPAVDMPFRDFFDRFQGMP
CNFPSIAPTLSRGRNSFIPIPYNTYAKIRLGPGWGAYYHFTYTSFPEGTGLPRFDGTFDR
EACLALAAADRKLSRRGWSALPRAKGDTLETLTVTVPPGEVRDVREITGNRAITGIRVVP
LELPEDPQRTARVLRELVFQVTWDNDESPSVWAPLGDFFGSVPGIQTYRALPQGSTDGGG
FYSHWFMPFSERAAIQVGNDGEEERRLLFTVCHRPLEKPAGDMLRFHAKWHRDAFLEKPA
REGRGIDWPLLMLGGGAGPGRFCGVQMHVWNRWEEPEVPADDWWYGVGGRKSVDWWWGEG
DEKFFVDGERFPSTFGTGSEDYVGYAWAAEPPFPAFESAYACQPHVELDANGHTSVCRFH
VCDDVPFRESFEAYIEKYKPNNWGRANKCLYAVVAYWYQGAGLRDAYESVPVGERYLELK
SPAGTRGDER

Enzyme Prediction     

No EC number prediction in EFQ34849.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH172	254	519	1.9e-62	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402651	DUF2961	7.85e-80	255	519	1	234	Protein of unknown function (DUF2961). This family of proteins has no known function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC75104.1|GH172	0.0	1	548	1	546
UPK45028.1|GH172	6.66e-213	4	539	10	547
QOS77213.1|GH172	1.54e-211	4	539	10	547
QLG40433.1|GH172	3.85e-205	5	541	13	551
QJD82055.1|GH172	9.86e-200	4	535	9	541

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KQ7_A	2.01e-22	218	523	42	331	Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492],4KQ7_B Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492]
7V1V_A	1.58e-19	255	535	103	378	Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_A Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1X_A Chain A, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_B Chain B, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_C Chain C, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_D Chain D, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_E Chain E, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_F Chain F, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium]

Swiss-Prot Hits     

EFQ34849.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999837	0.000193

TMHMM  Annotations     

There is no transmembrane helices in EFQ34849.1.