CAZyme Information: EFQ34785.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ34785.1
• CAZy Family: GH76
• CAZyme Description: Cutinase [Source:UniProtKB/TrEMBL;Acc:E3QV97]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
217		21980.89	6.4641

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697384:42499-43208(-)

Full Sequence      

MHRSTPALLLAVLGMASASPFAIVPRQADFSGNQQDGLSGPCQPTMVIFARGTTERGNVG
TLAGPPFFQALSAQVGGALAVQGVEYPASVQGFLAGGDAKGSQTMATLTEQAITKCPNSS
IIMSGYSQGGQLVHNAAAMMSQSMVASVAGAVIFGDPLNGQPVQGVPTQRTMVICHNGDN
ICEGGSQIRRAHLTYGDNAAEAAQFAASMTPPSAAAA

Enzyme Prediction     

EC	3.1.1.74:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	41	208	1.6e-41	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	2.61e-51	41	198	1	160	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC75356.1|CE5	3.62e-99	1	215	673	887
APA06574.1|CE5	2.11e-57	24	210	21	210
UPK99001.1|CE5	1.51e-56	1	207	1	205
ATZ46499.1|CE5	2.30e-55	39	206	32	200
CCD43152.1|CE5	2.30e-55	39	206	32	200

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	1.25e-41	16	205	64	242	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
5X88_A	1.70e-27	19	196	1	184	Chain A, cutinase [Malbranchea cinnamomea]
7CY3_A	9.67e-20	35	199	10	181	Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY3_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY9_A Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9],7CY9_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9]
1CUV_A	1.99e-19	36	199	25	195	Chain A, CUTINASE [Fusarium vanettenii]
1FFC_A	2.78e-19	36	199	25	195	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00298|CUTI_BOTFU	9.46e-54	42	205	31	195	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|Q9Y7G8|CUTI_PYRBR	9.75e-54	42	208	32	199	Cutinase pbc1 OS=Pyrenopeziza brassicae OX=76659 GN=pbc1 PE=1 SV=1
sp|Q8TGB8|CUTI_MONFR	1.36e-50	42	205	31	194	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|Q8X1P1|CUTI_BLUHO	1.58e-43	35	205	59	231	Cutinase OS=Blumeria hordei OX=2867405 GN=CUT1 PE=3 SV=1
sp|A0A024SC78|CUTI1_HYPJR	5.47e-41	16	205	64	242	Cutinase OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=M419DRAFT_76732 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000254	0.999721	CS pos: 18-19. Pr: 0.9698

TMHMM  Annotations     

There is no transmembrane helices in EFQ34785.1.