CAZyme Information: EFQ34723.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ34723.1
• CAZy Family: GH72|CBM43
• CAZyme Description: Glycosyl hydrolase family 2 [Source:UniProtKB/TrEMBL;Acc:E3QV33]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
868	GG697383|CGC3	98267.23	6.1535

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697383:135331-138055(+)

Full Sequence      

MALHRHELNSGWSFKQQDDASEHPWLPVPKVPSQVHVDLLANNKIPDPFLDMNELAVQWV
GEKTWVYRTSFTTPADPSDAPGRVTDLVFEGLDTFATVTLNGAVILRSDNMFLSHRVEVS
RQLRRGGADNVLEVVFDSALLRGRQLVQEHAHEHRFIARQTEQGRIPVRKAQYHWGWDWG
PILVTAGLWKPVFLERYLARLDDVWVKGEVSPDLKSVSGKIIVKIEGPGVDKVCVRFNLQ
NEIVLEKEFAVGEDGTAQTDFHLDNPRLWYPINTGPQTLYTVTATIHHASGIPLAAKTRK
TGFRRAELIQEPDTLGKSFYFRINNHDVFAGGSCWIPVGSFHAAVGPERYRAWAELMAAS
NQNMLRVWGGGVYEADALMEACDELGVMVWHDFCFACGSYPTYPSFLKSVEEEARQNLRR
LRGHPSIVIWAGNNEDYQVQERYRLEYRFDEDKDPESWLKTSFPARYLYEYLLPKIVGEE
SPLTTYHPSSPWGDGKPTADPTVGDLHQWNIWHGAMNKYQDAHLLTGRFVSEFGMEGYPH
LSTIATMLTAPSQRRPGSMALDFRNKAYDHERRLMTYIAENFSVAYDLPRFTHLTQLMQA
EAMSFAYKAWRRDWGTGGARGCGGALVWQLNDCWPTVSWAVVDYWLVPKPAFYAIARALR
ALDVGVRRRVDEWTKCHADPTLGARGTEFEVWVASGRTDAVAGDLTVRFISIETGREVRP
RLEKKVVAQGNATTDVVEKQTVGTAKEEFGDARVPYQQEADDPFVIHATLVVDGKLVAED
TAWPQPLKYLEFSDRRIRTSAEKGVLLISAEKPVKGFIIQEERGMKLSDNGFDIVPGEEK
VIRVEGIEVEELRWTYLGAPDASLRLSS

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	783	1.8e-92	0.7273936170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.73e-69	5	655	12	626	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	1.96e-13	687	789	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	6.68e-09	199	304	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236673	ebgA	3.64e-08	64	437	110	452	cryptic beta-D-galactosidase subunit alpha; Reviewed
397119	Glyco_hydro_2_C	0.001	316	437	12	137	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC76680.1|GH2	0.0	6	868	7	885
QLI66193.1|GH2	0.0	1	866	1	876
UNI14109.1|GH2	0.0	1	867	1	948
UKZ88363.1|GH2	0.0	7	867	7	888
UKZ77816.1|GH2	0.0	7	867	7	886

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.35e-129	7	669	28	663	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
6BYE_A	2.00e-112	8	860	8	858	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	2.05e-112	8	860	8	858	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	1.42e-111	8	860	6	856	Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	1.45e-111	8	860	8	858	Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1D911|MANBB_NEOFI	4.62e-304	3	858	4	844	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
sp|Q0CCA0|MANBB_ASPTN	7.00e-303	8	858	9	842	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
sp|Q4WAH4|MANBB_ASPFU	2.13e-302	3	858	4	844	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
sp|B0YBU9|MANBB_ASPFC	8.60e-302	3	858	4	844	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
sp|Q5B7W2|MANBB_EMENI	1.05e-299	2	858	3	842	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EFQ34723.1.