CAZyme Information: EFQ34242.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ34242.1
• CAZy Family: GH63
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:E3QTT0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
261	GG697378|CGC2	27808.17	5.0838

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697378:143043-143886(+)

Full Sequence      

MKPQALLSVAGAALLPPAFVTAAPADERASAAKPPAFFLAGDSTTAAQSEGGGGWGNGFL
GFLKEPAFGTNYGRNGRTTVDYVTMGYWDMVKDAVKANTANFDVYVTIQFGHNDQKPEKN
ISLGQYQTNLANLAGEIRALGATPVLVTPLTRRSFDSAGVVTNNLANERERTIAAAAAAG
VTYVDLNLNSRKYVQAVGEAKAHSYNLVPGDNTHLNDEGSVVFGRLVADLLLRKETQLAQ
WFTPDEALSEEIWKAIDSSPV

Enzyme Prediction     

No EC number prediction in EFQ34242.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE12	37	230	1.5e-47	0.9857142857142858

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238859	Rhamnogalacturan_acetylesterase_like	9.89e-61	35	231	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
238141	SGNH_hydrolase	5.35e-11	41	234	5	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	1.79e-07	70	219	37	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
225353	TesA	5.55e-07	28	231	2	208	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
238872	SGNH_hydrolase_like_2	0.002	105	228	64	189	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC81309.1|CE12	9.30e-66	55	252	52	248
AEO61167.1|CE12	1.18e-58	55	252	23	222
UJO18143.1|CE12	1.38e-57	55	252	45	245
QMW33442.1|CE12	2.22e-55	55	252	44	237
QRD85052.1|CE12	2.22e-55	55	252	44	237

PDB Hits     

EFQ34242.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31523|RHGT1_BACSU	3.11e-13	55	229	29	210	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002057	0.997922	CS pos: 22-23. Pr: 0.9787

TMHMM  Annotations     

There is no transmembrane helices in EFQ34242.1.