CAZyme Information: EFQ34149.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ34149.1
• CAZy Family: GH5|GH5
• CAZyme Description: GMC_OxRdtase_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:E3QTG1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
576		62772.87	6.1443

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697377:111606-113735(-)

Full Sequence      

MGSTPQDITYDFVICGGGTSGCVVACRLAEIPGASVLVIEAGAHNENLENVHMAGGWSQL
FDKETDWNVISERKPAVNDRQVKLSRGKFLGGCSGCNGTLCIRGSKQDYDDWGVDGWSGE
DFFKYIRKAEKFHGKSWFEASDDHGTSGYLNIEPHDLAPISNLIMDSMVSKGLPLDHDMF
SHGNNPHGCGHAPRTVHNGLRSTAADFVTKENKKNNLDLMVETHVEKVIIENADGELRAT
GVRVIKADGSAVQIKARKEVIVSGGAYCSPNILNRSGIGAKSELEAFGIPTLVDLPGVGK
NLMDHLIVFMFYETEKAGLTNDHHVYHGDNFAKTYALWKDQKAGFLSSFPFGAFAYARLD
ERLADSDLWKNAPRAPGRDPMGLTPKQPNIEFFTTECYGGPKQFDKFPTDGKHAFSMIAE
LFGPRSRGTVTLRNTDATAVPVVDTNYLADPLDVEVLAEACRFGNEIIMEGKGTKDIVKG
SWPSDLVHHKYSTREEWIPYVRDNATTCYHAAGTCAMGNASDPNAVVDPTLTVKGVKGLR
VADCSIMPILHGGHTQMPAYGIGEKAADLIKEAWAL

Enzyme Prediction     

No EC number prediction in EFQ34149.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	572	9.1e-161	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.08e-95	9	571	5	532	choline dehydrogenase; Validated
225186	BetA	1.64e-94	9	573	7	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.22e-37	424	566	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.33e-32	75	307	12	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.36e-24	3	546	49	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK91457.1|AA3_2	0.0	7	575	4	574
CZS80033.1|AA3_2	0.0	7	575	5	575
CEF76742.1|AA3_2	0.0	7	575	5	575
CEI60570.1|AA3_2	0.0	7	575	5	575
QPC69645.1|AA3_2	0.0	7	575	5	575

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	4.98e-72	10	571	7	570	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	6.96e-72	10	571	7	570	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	9.71e-72	10	571	7	570	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
4H7U_A	7.03e-64	5	574	36	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6ZH7_A	2.27e-63	3	570	1	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q47944|SDH_GLUOY	2.51e-77	10	571	5	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q988C9|4PADH_RHILO	9.26e-77	5	570	2	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q0R4L2|PDH3_LEUMG	9.30e-77	5	575	36	600	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q8UH55|BETA_AGRFC	2.43e-73	11	570	4	525	Oxygen-dependent choline dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=betA PE=3 SV=2
sp|P18172|DHGL_DROPS	9.54e-73	4	574	59	608	Glucose dehydrogenase [FAD, quinone] OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=Gld PE=3 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000003

TMHMM  Annotations     

There is no transmembrane helices in EFQ34149.1.