CAZyme Information: EFQ34084.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ34084.1
• CAZy Family: GH55
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:E3QT96]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
913		99695.94	5.0608

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697376:170205-173939(+)

Full Sequence      

MVNDNIKRKGSLPLVPEVASFGTCELEPSSPATLRYKRTKPGKEVKPGTELRILGVGDSI
TVGFLSDRNGGDGNGYRLQLRDDLSKDKVVFAGSETMSGTMDGNRFGAWSGQTIQHISDH
IGPSLKQRPNIVLVHAGTNDMNPSLDTAKQGNDPKGAADRLGKLLDKIIEACPDATVLVG
MIINTCDEKQSPATKEYQQLIPGVVKSRKDGGKHILAADFTTFETSHLQDCIHPSNDGYK
LFGSYWYDFITQIPKDWIQKPVGDGPKDDGNNGGLDKNIPAPDWGADPVTPTTPDTVRGA
YLNARPVETHTCNAKPFWGAGGQIALGNIGRNGDWKYKKNWVEAGKVADGLHRDPRFVRL
HDMNGDGKADYVWIHPDTGEIRCWINNLPEPWSKAGTNDDIIGSGAGPADLVFIALEDYM
VVNRNNGSVEIWWNYGPDDSWVNGWKFVEGGEIASGVPHANWETLRFPDINGDGRADYVY
IGEGGALQHHLNTGSVGGQDVLFLAQGGIASGAVDDISRLVFADKAFHCTPYIDQEPAKT
LADGISQKPESIRLADLDGDGKDDYAYIDDDGAIWLWYNRGGGHTSMLIDGLRFADIDGD
GTDDYVWLDPETGAPIVYTNYGYNANDEAFGYRWIPLNDGKPIASGAAPASQVTFGRITG
NDKADYIVVDPESGKLSVWQNMGPGKNSPDNWGWNEINVDASGLGPGKNVRIADIDGDGW
DDYIMLNKKGGTTIYRNMYLNSEEDHVWKPLPAADAEGIGQRPDEISDGKADYVWTRPHD
GAVFAWYNNYPNQPAWLPQGQIAEGWTSGHFVKWASMYLKRFEKLAKPWTSYLAVRPSDG
ALAVWFNGCKFGDHGPPTTLAPHSKAKSSSIQSFSNGIVSSTPYNSSYPFANTSKPLKSA
SKPIIRARLQHLT

Enzyme Prediction     

No EC number prediction in EFQ34084.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	51	250	1.4e-44	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.14e-42	51	250	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.65e-15	56	241	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	6.17e-11	53	249	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404411	VCBS	1.70e-07	556	607	1	61	Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).
395531	Lipase_GDSL	6.84e-04	53	246	1	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI80975.1|CE0	0.0	20	863	452	1321
CCT67685.1|CE0	0.0	20	863	452	1320
UQC90643.1|CE0	0.0	34	860	342	1216
UMZ45332.1|CE0	9.25e-295	19	850	457	1328
QPC64279.1|CE0	4.77e-263	19	849	16	718

PDB Hits     

EFQ34084.1 has no PDB hit.

Swiss-Prot Hits     

EFQ34084.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EFQ34084.1.