CAZyme Information: EFQ33900.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ33900.1
• CAZy Family: GH5
• CAZyme Description: Pectate lyase [Source:UniProtKB/TrEMBL;Acc:E3QSR2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
450	GG697374|CGC2	46317.65	7.2368

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697374:345107-346723(-)

Full Sequence      

MKVSAVLLAAAALFYQGAAAQPCKDASASCGAVRWGDATPAKVAARADSIPLAFPGAEGF
GRNAVGGRTGKVYKVTNLSDSGPGSLRDAVSQPNRIVVFDVGGVIKISSRIVVSKNIYIA
GQTAPGGGITVYGNGFSWSNANDAIVRHIRIRMGKGGDSGKDAITIADGKNLIFDHVSVS
WGREETFSISGDVTNVTVSDSIIAQGLETHSCGGLMQTDGGVSLFRNLYIDNKTRNPKVK
GVNDFQNNVVYNWGSGGGYIAGDSAGASYANIVNNYFISGPSTSVAAFTRGNANFRGYVR
DNFYDSNRDGALNGAALCVSATCYSDLAIQTAPFAYPPPAKLLAPAAAVAHVSARAGASI
SRDAVDAALLKELQSYGKSGKLISDEASAGGVGTVAPGTAKRDTDGDGIPDEWETANGLN
PNDASDGMKIGAGGYANLEIYVNSLAPAVY

Enzyme Prediction     

No EC number prediction in EFQ33900.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	102	277	2.2e-53	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366158	Pec_lyase_C	3.65e-06	109	256	28	195	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
214765	Amb_all	4.62e-06	100	281	1	190	Amb_all domain.
226384	PelB	1.12e-05	44	308	21	304	Pectate lyase [Carbohydrate transport and metabolism].
408654	TSP3_bac	1.21e-04	403	424	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC85972.1|PL1_2	5.69e-261	1	450	1	444
CEI60018.1|PL1_2	2.77e-212	52	445	20	413
QKD53272.1|PL1_2	2.44e-210	47	445	15	412
CCT64558.1|PL1_2	9.39e-208	47	445	15	412
UPL00982.1|PL1_2	1.33e-203	53	445	22	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FI2_A	2.96e-08	58	275	46	273	VexL: A periplasmic depolymerase provides new insight into ABC transporter-dependent secretion of bacterial capsular polysaccharides [Achromobacter denitrificans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WL88|PLYC_ASPFU	3.70e-190	52	450	22	419	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
sp|B0XMA2|PLYC_ASPFC	5.25e-190	52	450	22	419	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
sp|A1DPF0|PLYC_NEOFI	2.01e-187	52	450	22	419	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
sp|B8NQQ7|PLYC_ASPFN	9.07e-186	49	450	18	418	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
sp|Q2UB83|PLYC_ASPOR	8.55e-184	49	450	18	418	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000213	0.999755	CS pos: 20-21. Pr: 0.9780

TMHMM  Annotations     

There is no transmembrane helices in EFQ33900.1.