CAZyme Information: EFQ33887.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ33887.1
• CAZy Family: GH5
• CAZyme Description: Glyco_transf_20 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:E3QSP9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
903	GG697374|CGC3	102800.41	6.4045

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697374:295274-298290(+)

Full Sequence      

MTVFIASLFLPKTVHFALPGTSQRGDPLRRVKTDKAQRPEPNRQPSLFNPIRDITPPITP
TEEAIAEDPFTNEDGFRIFPEEERKLGAPVDKGSPKWGARATQPKSRASSPPPALIAEHS
RTLEKARELGRQGVTQPRPLVRSDSHDRVFAHANWRIMNADQGNGGLRNAAEAAARDGKL
GEYTWVGTLGMPTDALEGSQQKQDIEDRLATEHDMLTVFTSDKDFDGHYSHFCKQILWPV
FHYQIPDNPKSKAFEDHSWKYYVNVNQAFADKIIKNWKRGDVIWVHDYHLLLVPGMIRKK
LPEAKIGFFLHVAFPSSEVFRCLAVRKQLLEGMLGANLIGFQIHEYTRHFLQTCSRLLNV
EATTDGLQLEDRFVDVVNLPIGIDPVSLSEHRGDDDVKKWVEIMKERYQGKKLIVARDKL
DHVRGVRQKLLSYELFLNKNPDWRDKTVLIQVALSSSEKSDLDATVSDIVTRVNSSWANL
AYQPVVYLKQDIDYPQYLALLTMADALMITSQREGMNLTSHEYLFCQDGEVFPEKKHGSL
ILSEFTGTSSLFGGNELAVNPWDYRQCADAIKKALEMGNEEKERRWGALYSAVMHHTGSH
WFSEFLSRLDRVYDEQHKHDQTSVPRLNIHSLASRYKSSNRRLFILDYEGTLVSWGPMNQ
IIPVSPQRTLDVLNELLLDERNTVYIMSGRRPEELDRLFRRVPNLGLIAENGCFLKDCGK
NTWQEMADREQISSWKESVKSIMTYYLERTPGAEIEERRCSLIFHYKSAEDYESAARQAS
DCASHVNDACEEQRVHAIPLDGSILVEPIDWTKSTAAEKIFDDLRIHMEPDTEHQSPVDF
LMVVGDGREDEKVFKWANALGSEKVVQDVVTVSLHSRNTEAGFTLTQGVSGVLLALQKLA
TTQ

Enzyme Prediction     

EC	2.4.1.15:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	154	611	1.1e-159	0.9326315789473684

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	160	609	23	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	0.0	137	611	1	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
184712	PRK14501	1.67e-178	165	900	28	724	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
223457	OtsA	4.40e-167	156	609	35	477	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
215555	PLN03063	9.90e-140	182	854	52	717	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC86110.1|GT20	0.0	1	903	1	904
UPK91470.1|GT20	0.0	1	900	1	908
AEO53735.1|GT20	0.0	1	901	1	903
QYT02221.1|GT20	0.0	1	902	1	906
VBB71954.1|GT20	0.0	9	901	12	907

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JBI_A	5.39e-104	164	612	27	465	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVM_A	2.76e-100	164	612	39	477	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	1.99e-98	164	609	31	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	2.78e-98	164	609	31	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HVO_A	1.14e-96	164	609	38	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14081|TPSX_SCHPO	1.15e-200	98	899	133	941	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E11.16c PE=1 SV=1
sp|Q9UUI7|TPSY_SCHPO	2.29e-198	4	881	5	872	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22F8.05 PE=1 SV=1
sp|P38426|TPS3_YEAST	6.99e-165	149	797	308	929	Trehalose synthase complex regulatory subunit TPS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS3 PE=1 SV=3
sp|P38427|TSL1_YEAST	4.16e-164	145	816	336	983	Trehalose synthase complex regulatory subunit TSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TSL1 PE=1 SV=1
sp|Q54K57|TPSA_DICDI	1.35e-131	174	770	48	628	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.970664	0.029353

TMHMM  Annotations     

There is no transmembrane helices in EFQ33887.1.