CAZyme Information: EFQ33138.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ33138.1
• CAZy Family: GH37
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360		41494.59	5.0062

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697368:32391-33635(-)

Full Sequence      

MFFSHLRNLTYPHHLIDLAFLVSDSKDRTLQVLSNMLEEVQADEDAKQPYGEISIIEKDF
GQKVNQDVESRHGFAAQASRRKLMAQARNWLLSAALRPYHSWVYWRDVDVETAPFTILED
LMRHNKDVIVPNVWRPLPDWLGGEQPYDLNSWQESETALALADTLDEDAVIVEGYAEYAT
WRPHLAYLRDPYGDPDMEMEIDGVGGVSILAKAKVFRSGVHFPAFSFEKHAETEGFGKMA
KRMQYSVVGLPHYTIWHLYEPSVDDIKHMEEMEQERLAREKEEQEKAEKAKKVKEQFGDA
SSQWEKDKSDMQNMVTEEKNEAKGVKEIGDKKQAANNDEKPAKKERKEKNDAAFVKKAES

Enzyme Prediction     

No EC number prediction in EFQ33138.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	1	226	3.8e-111	0.8470149253731343

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	1.93e-143	1	226	38	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC75883.1|GT62	1.71e-208	1	327	133	460
UKZ59813.1|GT62	5.16e-199	1	314	122	435
ANH56547.1|GT62	5.25e-199	1	312	98	409
UPL03464.1|GT62	3.29e-198	1	319	134	452
UNI20376.1|GT62	4.52e-198	1	330	122	451

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	7.31e-60	2	262	40	304	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74745|ANP1_SCHPO	9.95e-145	1	271	115	385	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P32629|ANP1_YEAST	1.24e-144	1	269	98	366	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|P23642|VAN1_YEAST	1.00e-114	1	269	208	523	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	4.93e-112	1	269	112	430	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P39107|MNN9_YEAST	7.66e-59	2	262	130	394	Mannan polymerase complexes subunit MNN9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN9 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EFQ33138.1.