CAZyme Information: EFQ31865.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ31865.1
• CAZy Family: GH18
• CAZyme Description: GPI mannosyltransferase 1 [Source:UniProtKB/TrEMBL;Acc:E3QLX7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421		47039.26	9.7171

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697358:111808-113173(-)

Full Sequence      

MAGLDALFRPVPLFATAAVLRVVMLYYGLWQDAYSAVKYTDIDYLVFTDAARFTAQGRSP
YDRETYRYTPLLAWMLVPTASQACFAFGKFVFAAADLIAGYYIVRILDRRGVEQAKALKF
ASIWLLNPMVATISTRGSSEGLLGVTVMALLWAVLEGRTTLAGLLLGFGVHFKIYPFIYA
PAIVWWMDEDALGRKGTNAHGKTLGETIANFLNTERIKLAVVSLATFMGLNVAMYSIYGA
PFLVHTYFHHVTRIDHRHNFSPYNILLYLTSAFPSTSAIRIESVAFLPQILLSTILIPFI
LAKKDLATSMMAQTFAFVTFNKVCTSQYFLWYMVFLPIYLPNSSFLKNPKLGVTALALWI
VSQAAWLHQGFQLEFLGVSTFFPGLFAASVGFFLVNCWILGVIVNDGGKETATHTKRKIK
Q

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	133	404	5.2e-95	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	1.35e-90	1	405	1	416	GPI mannosyltransferase
252941	Mannosyl_trans	8.03e-73	133	404	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
399599	PIG-U	9.38e-05	55	252	45	243	GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC88764.1|GT50	5.01e-241	1	416	41	457
UPK97783.1|GT50	1.07e-206	1	407	1	408
ATY62242.1|GT50	8.04e-206	3	409	16	432
UKZ90890.1|GT50	4.40e-204	4	409	6	407
UKZ48798.1|GT50	1.19e-201	4	410	6	408

PDB Hits     

EFQ31865.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I073|GPI14_GIBZE	6.73e-198	1	415	1	416	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	2.58e-177	9	409	25	487	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	3.24e-175	9	410	7	413	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q5B7W0|GPI14_EMENI	2.17e-170	4	420	1	443	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q4WAH2|GPI14_ASPFU	2.92e-166	10	408	8	422	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000000

TMHMM  Annotations     

Start	End
7	29
85	107
137	154
164	186
219	241
279	301
314	336
382	404