CAZyme Information: EFQ31321.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ31321.1
• CAZy Family: GH16
• CAZyme Description: GH131_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:E3QKD3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303	GG697354|CGC4	32362.21	4.7017

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697354:451789-452849(+)

Full Sequence      

MFSRAALLLLLTPATLAAATPNCHAAAVRCPIVFDGRVPAVATPQDFDTASGGGWNPYNP
GYVKGEGLLWSDIILLPLPSPQEEEEEAAPPSRFDAGGGTRPLEVTVSDRSIFMNQRGFR
RAGLQFAADANVGSPAAAGVKTLHFSVRQDAARPLNLTHEYLNVWHETAAYDANQFNFQT
GTLIGREGLLPKDTFKLLDRDNKLLWSTPVATDGSWQNFALTLDFSKNTIQVWYSTGGAR
LASQGGAIPANLAGDGQYQIGILKKPTGTSDVVNSGYQSSNLDEGQIYGGIFIEDGADGC
VSL

Enzyme Prediction     

No EC number prediction in EFQ31321.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	32	299	2.9e-66	0.9725490196078431

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	1.82e-92	32	299	1	251	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC86340.1|GH131	2.45e-152	8	303	9	301
UPK91234.1|GH131	2.13e-120	30	302	82	342
QKD55659.1|GH131	7.78e-114	26	303	29	294
QGI96469.1|GH131	1.57e-113	26	303	29	294
QGI65589.1|GH131	1.57e-113	26	303	29	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W9A_A	8.65e-08	32	296	3	225	Chain A, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_B Chain B, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_C Chain C, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_D Chain D, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130]

Swiss-Prot Hits     

EFQ31321.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000320	0.999631	CS pos: 19-20. Pr: 0.8707

TMHMM  Annotations     

There is no transmembrane helices in EFQ31321.1.