CAZyme Information: EFQ31289.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ31289.1
• CAZy Family: GH16
• CAZyme Description: Glycosyl hydrolase family 2 [Source:UniProtKB/TrEMBL;Acc:E3QKA1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642		71479.84	4.8646

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697354:308128-310335(+)

Full Sequence      

MRLTQALLSSALAALSMAATTNTLNATTTSGGGSAPTSGSAEPYKLQTPPLDTDWTSKVG
TNPWPEHPRPQLRREKWLNLNGIWTYRAASGGDDVNHPPSGSTLDREVLIPSCIESGLSG
LQELGVSHFWLATTFQVPMDWGNQTVLINFEAVDYEATVFINGQKAGFHRGGYFRFTIDA
TMYLKPGGNNTLLVFVFDPTDEPGYVVPIGKQTRSPSHIFYRSCSGIWQTVWLESTPQNR
ITQLDVAADHQGNVNVLVHSYSSPPSQVHIAVIDNNGQTIGESDGTSDSPFNFTVSSPNV
WSPSNPNLYNITVTMGRDKVSSYTGFRTISTGMVDGVKRPLLNGEFIFMFGTLDQGYWPD
GLYLPPTVEAMTYDLKVLKNLGMNMVRKHIKVEPDLFYHACDTLGLLVIQDMPSLTADSS
RLPNPEQQAEFERQLQLMIQEHKSYTSIVTWTIYNEGWGQLRGPPYPEETLVEIVRKIDP
TRLIDANSGWYDHGFGDYSDNHHYANPQCGTPFYSLASSPYDASRIGFQGEFGGIGHNVS
IEHLWNVQQAIDTINQTYEIDENLEAYNYRGRVLLREFREQVEMYACSGGVWTQTSDVEG
EVNGLVTYDRRVLRPDIAQWQVDIKSLFDAARSRSGSVNGTM

Enzyme Prediction     

EC	3.2.1.146:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	71	505	7.2e-98	0.4933510638297872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	7.88e-41	80	531	15	498	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	5.55e-31	78	482	13	443	beta-D-glucuronidase; Provisional
236673	ebgA	6.09e-23	133	484	115	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
397120	Glyco_hydro_2_N	2.40e-12	130	237	68	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
236548	lacZ	8.24e-09	133	459	126	466	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC86416.1|GH2	0.0	1	642	1	641
QLI73958.1|GH2	0.0	39	637	26	623
QYS93190.1|GH2	0.0	38	634	20	614
UNI13367.1|GH2	0.0	43	636	33	622
UKZ84644.1|GH2	0.0	43	634	27	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	2.13e-98	51	616	12	571	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5C70_A	3.09e-27	78	489	21	456	The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
5C71_A	8.12e-27	78	489	46	481	The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]
3GM8_A	2.06e-25	119	484	60	421	Chain A, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
7VQM_A	8.70e-23	130	486	97	438	Chain A, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_B Chain B, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_C Chain C, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_D Chain D, GH2 beta-galacturonate AqGalA [Aquimarina sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KPJ7|PLH8_FORAG	3.55e-25	79	498	55	497	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|T2KM09|PLH16_FORAG	4.15e-20	130	489	109	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|Q56307|BGAL_THEMA	4.78e-18	43	484	2	464	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
sp|O52847|BGAL_PRIM3	6.78e-16	134	500	140	519	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
sp|P26257|BGAL_THETU	6.99e-16	143	482	70	411	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000284	0.999681	CS pos: 18-19. Pr: 0.9796

TMHMM  Annotations     

There is no transmembrane helices in EFQ31289.1.