CAZyme Information: EFQ30919.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ30919.1
• CAZy Family: GH13|GH13
• CAZyme Description: Mannan endo-1,6-alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:E3QJ81]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	GG697352|CGC1	43290.77	4.5599

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697352:49748-51091(+)

Full Sequence      

MVFVRPALIASVAAATVSAFTAPNTLDVTKPDSVKAVARSLAFGAMSYYNGNVSSDPKMV
GDLPDPYYWWQAGALWGIMVDYFRYTGDATYNDVLTQALTATVNTGPNFDFMPPEHAFEE
GNDDLGFWGFAVMAAAEGNLTQPNASVPSWLTMGRNIFNSLATRWNMTHCGGGLLWQIYE
TNPNGLNYKNSVSNGGFFQLGARLAAATGDAAYVAWANYIWDWSVNVGFIDQNLKVYDGA
DSRDNCTKTNYLSFTYSTGIYLYGAAVMANHTGDAVWKQRATKMLETARSSFFSPAANST
NIMYEPACEPVNTCNTDMKSFKGYLSRFLWKSAIVMPELLPAVREILVPSALAAANVCEA
TETNVVCGQKWYVGGNDGSLGLGQTMSALEVVQGLVASQ

Enzyme Prediction     

No EC number prediction in EFQ30919.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	32	397	7.1e-87	0.9273743016759777

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	3.89e-147	33	389	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	9.23e-07	67	345	44	290	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC76003.1|GH76	3.35e-243	1	399	1	401
UPK97622.1|GH76	1.10e-170	21	396	19	394
UKZ85257.1|GH76	8.11e-165	13	396	10	395
UKZ47137.1|GH76	1.33e-162	13	396	10	394
QPC72761.1|GH76	1.47e-161	1	399	1	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.59e-74	38	396	40	403	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q75DG6|DCW1_ASHGO	4.97e-97	26	395	24	386	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|P36091|DCW1_YEAST	5.91e-95	20	392	18	381	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	1.91e-94	25	393	21	381	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q6FLP9|DCW1_CANGA	8.57e-94	26	392	21	378	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	4.55e-92	18	396	13	388	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000728	0.999277	CS pos: 19-20. Pr: 0.9788

TMHMM  Annotations     

There is no transmembrane helices in EFQ30919.1.