CAZyme Information: EFQ30467.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ30467.1
• CAZy Family: GH128
• CAZyme Description: UDP-glucose:Glycoprotein Glucosyltransferase [Source:UniProtKB/TrEMBL;Acc:E3QHX9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1492	GG697349|CGC4	167005.68	4.7836

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697349:463139-467743(+)

Full Sequence      

MLRLSRLPMGLALTLSAAVNVLAVPSVTVDMKAAFPSGPYLLELLETAAGENATAYFPLL
DRIANGYFSEAKTDKDVYDKFLHVLNEDGHVNTPDALSTFKLALSLRTAAPRIEAHYQYY
RTAVEPKLGSDAQDGCEAWVELGGKQYCAPTLDTPKEPESALDGSKVLPFDRVLGSGGEA
ILYADPASSAFGPFHSTLAEKARKGEIEYRLRYTKPAGIYEEPLPVSGYGVELALKRTDY
IVIDDREAQSDDSQKIANAGEVLDAAEDVADLKPLAKSELQELGLKAASFIMQSQDPFET
LLRLTQDFPKFSTSIAAHNVSTNFLAEHQLNRQQLVPSGMNVLWMNGVQLIERQIEAFTI
IDLLRRERKLIDGVRDLGFTGGQAVSLLGHPKVAESKADDEPPRFDWTDDEEKEEVIMFL
NDLEKDERYKDFPSQLTALLQRVYPGQLPPIRRDIFNLIVPVDFSKIEDLNVVAQLNTFI
QRKVPIRFGLVPLTPTEDAAKITKVLYYLLDNYGLEVFIEYLDAAMQDAKTEKPDQSVFE
KAIKDREPLPTAKLLAFDDVLQSQELHNVLELARSWVKRLNANTPIPPVFINGIPVPREN
NWLQAMSMKASSDLQTIQRAVYFGAITEEVWFPDFFLEKAVKRRNTYIYPEDDKSIKILD
VNKIYTEHDGLFSNIPAIEAYADSTKENWAVLTIVGDFVSDQGASLLLTALAFRRSNPGV
RLDIVYNPPTSASASAVNTALKNSGDKLAEVESISDLKAIFDSAAVEPDGMFTAALSKFL
SFAAIKPGSNLVILNGRVIGPFTEAEPFQGDDFQFLLEFEQKARILPVYAAVDDLGLTDK
ISGPLAAAKITSVTALSTISDLPADIFESAPSMRVSAHDQWNSTYTAIEIGNPETSSVHI
VGVLNPASEQAQRWAPILKVVSKLDGVYLKLFLNPQEKIDELPVKRFFRYVLESEPSFDE
AGKVRGLEASFKGLPSEALLNAGMDVPPSWLVAPKVSVHDPDNIKLSSIKSNVYASYELE
SILIEGHSREGGQSQPPRGAQLVLGTEKEPHFADTIIMANLGYFQFKASPGFYNIQLKSG
RSSEIYTIDSIGAKGWNPVPGDEGTEVVLMDFQGTTLYPRLSRKPGQEEADVLAEPEDNS
IVGRGLKFAEGILGKKKSASDEEHAEINIFSVASGHLYERMLNIMMVSVMKNTKHTVKFW
FIEQFLSPSFKDFIPHMAKEYGFKYEMVTFKWPHWLRQQKEKQREIWGYKILFLDVLFPL
SLDKVIFVDADQIVRTDMISLVNHDLEGKPYGFTPMCDSRTEMEGFRFWKQGYWANYLRG
QPYHISALYVVDLRRFRELAAGDRLRQTYHSLSADPNSLANLDQDLPNHMQFQIPIHSLP
QEWLWCETWCSDESQKDAKTIDLCNNPQTKEPKLDRARRQVPEWSVYDNEIAALDRKRKG
LLVEAPKKEETKAGGGGEGEQQKPVIAEEDKNTKSRNWEEPPAENTHVIDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1167	1414	7.5e-135	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133054	GT8_HUGT1_C_like	0.0	1167	1414	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408203	Glyco_transf_24	0.0	1167	1434	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
408201	Thioredoxin_14	1.50e-99	405	648	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408202	Thioredoxin_15	3.04e-69	660	855	1	204	Thioredoxin-like domain. This is the fourth TRXL(thioredoxin-like) domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
399437	UDP-g_GGTase	1.79e-65	1025	1134	1	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC87132.1|GT24	0.0	1	1492	61	1551
UPK89075.1|GT24	0.0	1	1492	1	1462
QKD49569.1|GT24	0.0	11	1492	8	1464
CCT67477.1|GT24	0.0	13	1439	1	1430
QPC73004.1|GT24	0.0	11	1451	8	1448

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	0.0	20	1437	4	1450	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	0.0	20	1437	4	1450	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5Y7O_A	0.0	26	1133	5	1123	Crystal structure of folding sensor region of UGGT from Thermomyces dupontii [Thermomyces dupontii],5Y7O_B Crystal structure of folding sensor region of UGGT from Thermomyces dupontii [Thermomyces dupontii]
6TRT_A	0.0	20	1437	4	1450	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	0.0	20	1437	4	1216	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	7.52e-262	29	1434	24	1424	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	9.56e-254	27	1434	30	1507	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	1.45e-248	26	1434	46	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	4.87e-245	26	1434	46	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	1.13e-243	26	1449	46	1543	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000252	0.999723	CS pos: 23-24. Pr: 0.9727

TMHMM  Annotations     

There is no transmembrane helices in EFQ30467.1.