CAZyme Information: EFQ30446.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ30446.1
• CAZy Family: GH128
• CAZyme Description: DUF1929 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:E3QHV8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
506	GG697349|CGC2	53934.06	8.0777

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697349:380578-382421(+)

Full Sequence      

MPTLRSALRNLPAALLALAAACEAQNVGKWGPMVKFPVVPVAVALVPETGNLLVWSSGWP
NRWTTAGNGKTYTSLYNVNTGNISDAIVQNTQHDMFCPGTSLDADGRIIVTGGSSAAKTS
VLDFKKGESSPWTPLSNMQISRGYQSSCTTSEGKIFVIGGSFSGAGTRNGEVYDPKANTW
TKLAGCPVKPLVMQRGMFPDSHAWLWSWKNGSVLQAGPSKKMNWYDTKGTGSNTPAGLRG
TDEDSMCGVSVMYDAVAGKIFTYGGGKGYTGYDSTSNAHILTLGEPGQAVQVQKLANGKY
NRGFANAVVMPDGKIWVVGGMQKMWLFSDTTPQLTPELFDPATGSFTPTTPHTVPRNYHS
TALLMADATIWSGGGGLCGANCKENHFDGQFWSPPYLFEADGVTPAKRPVIQSLSDTAVR
AGAPITITMQDAGAYTFSMIRVSATTHTVNTDQRRIPLDGQDGGDGKSFTVNVPNDYGVA
IPGYYMLFAMNEAGVPCVAQFFKVTL

Enzyme Prediction     

EC	1.1.3.9:34	1.1.3.13:3	1.1.3.-:1	1.1.3.7:1	1.1.3.47:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	21	504	1.2e-210	0.8112244897959183

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199882	E_set_GO_C	5.51e-31	404	504	2	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
401164	DUF1929	7.34e-25	414	504	1	91	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
276965	Kelch	3.61e-13	105	184	10	89	Kelch repeat. Kelch repeats are 44 to 56 amino acids in length and form a four-stranded beta-sheet corresponding to a single blade of five to seven bladed beta propellers. The Kelch superfamily is a large evolutionary conserved protein family whose members are present throughout the cell and extracellularly, and have diverse activities. Kelch repeats are often in combination with other domains, like BTB and BACK or F-box domains.
276965	Kelch	4.25e-13	105	188	57	140	Kelch repeat. Kelch repeats are 44 to 56 amino acids in length and form a four-stranded beta-sheet corresponding to a single blade of five to seven bladed beta propellers. The Kelch superfamily is a large evolutionary conserved protein family whose members are present throughout the cell and extracellularly, and have diverse activities. Kelch repeats are often in combination with other domains, like BTB and BACK or F-box domains.
396078	Kelch_1	3.76e-07	142	187	1	46	Kelch motif. The kelch motif was initially discovered in Kelch. In this protein there are six copies of the motif. It has been shown that the ring canal kelch protein is related to Galactose Oxidase for which a structure has been solved. The kelch motif forms a beta sheet. Several of these sheets associate to form a beta propeller structure as found in pfam00064, pfam00400 and pfam00415.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EFQ30446.1|AA5_2|1.1.3.13	0.0	1	506	1	506
UBS89875.1|AA5_2	0.0	1	506	1	506
UBS89876.1|AA5_2	0.0	1	506	1	506
OBR05259.1|AA5_2|1.1.3.13	0.0	1	506	1	506
EHA47002.1|AA5_2|1.1.3.13	1.01e-248	26	506	124	611

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C86_A	0.0	25	506	1	482	Novel fungal alcohol oxidase with catalytic diversity among the AA5 family, apo form [Colletotrichum graminicola M1.001],5C92_A Novel fungal alcohol oxidase with catalytic diversity among the AA5 family, in complex with copper [Colletotrichum graminicola M1.001]
2WQ8_A	5.91e-148	26	505	179	660	Chain A, GALACTOSE OXIDASE [Fusarium graminearum]
2EIC_A	5.47e-146	26	505	157	638	Chain A, Galactose oxidase [Fusarium graminearum]
6XLT_A	1.01e-145	26	505	158	639	Chain A, Galactose oxidase [Fusarium graminearum]
1GOF_A	3.09e-145	26	505	157	638	NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],1GOG_A NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],1GOH_A NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],2EIE_A Chain A, Galactose oxidase [Fusarium graminearum],2JKX_A Chain A, GALACTOSE OXIDASE [Fusarium graminearum],2VZ1_A Chain A, GALACTOSE OXIDASE [Fusarium graminearum],2VZ3_A Chain A, Galactose Oxidase [Fusarium graminearum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1S2N3|GAOA_GIBZE	5.40e-144	26	505	198	679	Galactose oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GAOA PE=3 SV=1
sp|P0CS93|GAOA_GIBZA	5.40e-144	26	505	198	679	Galactose oxidase OS=Gibberella zeae OX=5518 GN=GAOA PE=1 SV=1
sp|Q9FYG4|GLOX1_ARATH	7.89e-11	72	504	157	614	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|Q3HRQ2|GLOX_VITPS	8.11e-09	292	500	297	517	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|D4AUF1|WSCD1_ARTBC	3.62e-06	94	504	482	903	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000626	0.999358	CS pos: 21-22. Pr: 0.9197

TMHMM  Annotations     

There is no transmembrane helices in EFQ30446.1.