CAZyme Information: EFQ30380.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ30380.1
• CAZy Family: GH125
• CAZyme Description: Endo-1,4-beta-xylanase [Source:UniProtKB/TrEMBL;Acc:E3QHP2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
232	GG697349|CGC5	25648.96	7.2981

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697349:179865-180625(-)

Full Sequence      

MVSFKFLLLATAAVTAVLGRPFDFLDEVDDGNSTEVLERRQVTPNSEGTHNGYFYSFWSD
GGGRVQYTMGAGSRYSVSWSNVGNFVGGKGWNPGNGRTINYGGSFSPNGNGYLAVYGWTR
NPLVEYYVVESYGTYNPSSGGQYKGTVTTDGGTYDVYVSTRYNQPSIDGTRTFQQYWSVR
QGKRVGGSVNMQNHFNAWARYGLNLGTHYYQIVATEGYQSSGSSDIYVQTSW

Enzyme Prediction     

EC	3.2.1.8:61

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	51	226	2.4e-76	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	9.41e-109	51	225	1	175	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP22289.1|GH11	3.36e-147	1	230	1	229
VBB71277.1|GH11	9.62e-147	1	230	1	229
CAA06151.1|GH11|3.2.1.8	7.18e-140	1	230	1	230
ACR92584.1|GH11|3.2.1.8	7.18e-140	1	230	1	230
CAD70174.1|GH11	2.06e-139	1	230	1	230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZSE_A	7.06e-90	42	231	2	189	3D Structure of a thermophilic family GH11 xylanase from Thermobifida fusca [Thermobifida fusca]
7DFM_A	3.28e-89	42	228	5	190	Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFN_A Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_A Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_E Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_F Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_G Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_H Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_I Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis]
1M4W_A	1.01e-88	42	226	4	186	Thermophilic b-1,4-xylanase from Nonomuraea flexuosa [Thermopolyspora flexuosa]
7EO6_A	1.35e-88	42	231	6	193	Chain A, Endo-1,4-beta-xylanase [Actinomycetia bacterium],7EO6_B Chain B, Endo-1,4-beta-xylanase [Actinomycetia bacterium]
1HIX_A	1.61e-88	42	228	4	189	Crystallographic Analyses Of Family 11 Endo-Beta-1,4- Xylanase Xyl1 From Streptomyces Sp. S38 [Streptomyces sp. S38],1HIX_B Crystallographic Analyses Of Family 11 Endo-Beta-1,4- Xylanase Xyl1 From Streptomyces Sp. S38 [Streptomyces sp. S38]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0ZHI9|XYNG_VERDA	1.19e-138	1	230	1	232	Endo-1,4-beta-xylanase G OS=Verticillium dahliae OX=27337 GN=xynG PE=1 SV=1
sp|I1S2K3|XYNA_GIBZE	2.92e-130	1	231	1	231	Endo-1,4-beta-xylanase A OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=XYLA PE=1 SV=1
sp|Q9HGE1|XYN2_HUMGT	1.55e-124	1	230	1	226	Endo-1,4-beta-xylanase 2 OS=Humicola grisea var. thermoidea OX=5528 GN=xyn2 PE=1 SV=1
sp|P55334|XYN1_HUMIN	4.45e-124	1	230	1	226	Endo-1,4-beta-xylanase 1 OS=Humicola insolens OX=34413 GN=XYL1 PE=2 SV=1
sp|A1DJ52|XYNA_NEOFI	9.88e-112	1	228	1	227	Probable endo-1,4-beta-xylanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=xlnA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000228	0.999728	CS pos: 19-20. Pr: 0.9782

TMHMM  Annotations     

There is no transmembrane helices in EFQ30380.1.