CAZyme Information: EFQ30299.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ30299.1
• CAZy Family: GH12
• CAZyme Description: Endo-1,3(4)-beta-glucanase [Source:UniProtKB/TrEMBL;Acc:E3QHD7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
876	GG697348|CGC8	94478.87	6.6041

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697348:559197-562041(+)

Full Sequence      

MAGLHLKMTIVGLTLIQVLFCESAHALSHQQHVRLHPAHPGPEIVGQLNVRSLLLDRRDL
TCVTETANFTVTVKVTRGAQQTSASASGTIDDISAITTADPTGTVIILPSLTDKIPQTTG
FIPSSLDTSGKATSCPLMSNSIPVPTSLIDSTSPVTTVAPIPSATMPSGNIFAEPIATMA
PPGSIPARSDHPVPRKGITSTSPLQTNKFFSNFFLGDQTAPTYTYPYSIAWGAGRGAAAS
FGMTISHVEANQRVFGPNKPSGAAAYFINPVGIQSMVISAQELGSDTTVGVDNITAFSAT
VHLKPNAQAVPAVSFPLVQGMPFVTARYAGATPVIKTGVFFKTVTRVTQDPKPGVAKYNF
QLEDGKIWRLYAYATTGSQLNLQVVNNGLAQSTQPFYGIIQVAKDPGNGEALLDQAAGVY
PTTIELAGSVSGNTGSYSFNFSKEGHPGGKLVMFALPHHVSSFDPTTRNAVQPVQMMTPT
KGIATAVLADQWTMTEANMPIDMHFAPWSPGRGSLTMLSDNARAVIRGIAAQEVSQDMMA
QSDLDSMYFSGKALAKFALLIVVINDILQDPALAQSGLNRLKAAFAKFASNQQKFPLVYE
SAWGGVVSSATYVTGNDGADFGNTQYNDHHFHYGYHILAAAAIAHLDPGWLNNNRDYVNT
LVRDVANPSTKDTYFPTWRAFDWYHGHSWAHGLYASYDGKDQESSSEDMMHAYALKMWGD
ASGDGMLSMRSNLQLSIIARALQHYYLYKSDNVVQPPQFIGNKVAGILFENKIDHTTYFG
ANIEFIQGIHMIPLLAPSPFVRTPDFVREEWDVYFSGGRVDSIAGGWRGIIYGNLATIDG
RTAWDFFNSTNFDPGWIDGGASLTWYLTYAALMGNI

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	196	869	2.6e-219	0.9807073954983923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	0.0	518	867	2	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	0.0	120	875	6	757	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	3.67e-152	191	510	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC73708.1|GH81	0.0	18	876	1155	2014
AEO64126.1|GH81	0.0	96	876	95	875
UNI22551.1|GH81	0.0	166	876	1	713
UKZ86758.1|GH81	0.0	166	876	1	714
UKZ76665.1|GH81	0.0	166	876	1	714

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.20e-90	206	855	43	705	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.02e-90	206	855	68	730	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	3.13e-88	206	855	43	705	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.13e-23	599	812	393	600	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5UPI_A	4.12e-21	201	812	46	624	Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPM_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPN_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPO_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	1.19e-251	123	871	148	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	3.89e-177	186	875	17	704	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q12168|ENG2_YEAST	6.57e-160	160	870	64	775	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.86e-158	170	871	46	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	4.14e-148	170	875	401	1114	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000191	0.999792	CS pos: 26-27. Pr: 0.9728

TMHMM  Annotations     

There is no transmembrane helices in EFQ30299.1.