CAZyme Information: EFQ29370.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ29370.1
• CAZy Family: GT90
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:E3QER4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
565	GG697344|CGC3	57853.36	5.0488

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697344:672038-673871(-)

Full Sequence      

MKGSILAVAAAIGGVSAAAHRHAQAHGQLFKRGVDQASVCVPGCTTIYTTIYGEPTLVPH
KPSSPPAVVPSAPATTEAPPKPTSTQKPSVDVPTPVPEVCPTPGTYTFPATTITVSQTTT
VCAPETTKVPAGTHTIGGVTTVVVSATTVVCPYATAKTSSGVVTSVVETTTYVCPTPGTY
TIAPTTTTVTAPTNVVYPVVTTVNPGTYVRPAIVTTITETSVVVVCPFTSQEPVPTTSSV
VVPAPVPTTSAIPAPVPTTSAAPEPVPTTTAKASSSAPAPSSSAPATGGGLGGNNGDHWA
ITYTPYSEDASGSCKSGSQVDSDIASIKNSGFRTIRIYSTTDCNALENVGAACEKYGLKM
ILGIFVKDSCDPQSADIKTQVDAIASWQRWDMVELVVVGNECIFQGRCSASSLKQLIVAT
KVTITAAGYSGPYTTAETVGVWQQTDVVSEICDVVDIVGGQIHPYFNAQTAATDAGTFVQ
SQIELLESSSICGSKPALNLECGWPASGSCNGLACPGTSEQAIAIASIKELAGSKTVFFS
FHNDLWKAPGACGCEQSWGCGQLFL

Enzyme Prediction     

EC	3.2.1.-:1

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	3.97e-54	300	559	47	299	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
411474	fibronec_FbpA	2.31e-04	59	131	164	239	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.
223021	PHA03247	2.39e-04	56	267	2719	2901	large tegument protein UL36; Provisional
223021	PHA03247	2.41e-04	59	267	2701	2931	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC80459.1|GH17	3.08e-240	1	564	1	584
UKZ62194.1|GH17	4.47e-134	1	564	1	563
UKZ92158.1|GH17	3.64e-129	1	564	1	560
ACM42427.1|GH17	3.83e-126	1	564	1	532
ACM42426.1|GH17	3.83e-126	1	564	1	532

PDB Hits     

EFQ29370.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1C499|BTGE_ASPCL	1.70e-99	1	564	1	564	Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgE PE=3 SV=1
sp|Q0CEX9|BTGE_ASPTN	3.05e-90	1	564	1	558	Probable beta-glucosidase btgE OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgE PE=3 SV=1
sp|B0Y9Q9|BTGE_ASPFC	2.82e-89	1	564	1	564	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2
sp|Q4WC60|BTGE_ASPFU	2.82e-89	1	564	1	564	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2
sp|A1DBG6|BTGE_NEOFI	6.94e-86	1	564	1	551	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000764	0.999220	CS pos: 17-18. Pr: 0.9774

TMHMM  Annotations     

There is no transmembrane helices in EFQ29370.1.