CAZyme Information: EFQ29261.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ29261.1
• CAZy Family: CE5
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:E3QEF5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430	GG697344|CGC1	44553.41	5.1966

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697344:167533-168884(-)

Full Sequence      

MRSITSIAIAASLAAGVVAQPHNHRHHHVKKDAASPIGKRDVVVVYENGPTVTTYELGGT
PISEEEAKKGIQDGLYVVIGETTPSSSPLPPASTSKSPQPSKDAQFFEAKVEKSTPSPTP
TPTPTPTPSPSPSSKAAPTSTASPSGGSSGGGVDSEFPSGTIPCSHFPSDYGAVPVDYLG
TGGWTGIQKTPDYSIGDAVISFIETAVSGDSSCPKKSFCSYSCGVGYQKTQWPSAQGATK
QSIGGIYCNSNGFLELTRPEKTTLCEPGAGGVTVKNDLDQQVSVCRTDYPGTESMVIATV
PQPGQTLELTNPLSSDYYVWDGSPTTAQYYVNKAGYSAEDSCVWKSSLDPLGAGNWAPIN
VGTGKSADGNTYISIFNNAPTSVAKLDFNVEIVGDVNSKCALIDGVYTGGGTGCTTAISG
NGKATIRFFK

Enzyme Prediction     

No EC number prediction in EFQ29261.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	129	428	4.5e-94	0.9438943894389439

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	1.15e-125	159	407	1	234	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC80645.1|GH132	1.04e-219	1	430	1	438
UPK97954.1|GH132	1.22e-140	1	429	1	437
UKZ92543.1|GH132	5.88e-140	49	429	50	432
QPC75848.1|GH132	5.99e-140	1	429	1	443
CEF73471.1|GH132	6.86e-139	1	429	1	443

PDB Hits     

EFQ29261.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WGL5|SUN1_ASPFU	1.28e-77	6	429	5	414	Secreted beta-glucosidase sun1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=sun1 PE=1 SV=1
sp|D4AM57|SUN41_ARTBC	2.43e-73	4	428	7	446	Probable secreted beta-glucosidase ARB_04747 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04747 PE=1 SV=1
sp|P53616|SUN4_YEAST	3.71e-67	152	430	158	420	Probable secreted beta-glucosidase SUN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUN4 PE=1 SV=1
sp|O43015|YBOH_SCHPO	1.48e-65	154	420	56	311	Probable secreted beta-glucosidase C2G2.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2G2.17c PE=3 SV=1
sp|P40472|SIM1_YEAST	2.45e-64	152	424	214	470	Probable secreted beta-glucosidase SIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIM1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000293	0.999646	CS pos: 19-20. Pr: 0.9780

TMHMM  Annotations     

There is no transmembrane helices in EFQ29261.1.