CAZyme Information: EFQ29240.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ29240.1
• CAZy Family: CE4
• CAZyme Description: Trehalase [Source:UniProtKB/TrEMBL;Acc:E3QED4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
679		76120.17	4.7643

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697344:98921-101160(-)

Full Sequence      

MINIALALAALSVLPQAAQALYENGSVIAPCDSPIYCHGEILKEIELARPFSDSKTFVDM
PATKSLEAIQAAFNKLAKPLSNNTELNDFLLDNFAQAGNELKEVPKEQLITDPKFLNNIN
DTVIKEFSQKVIDIWPDLTRTYVGSGGNTSFPNSFIPVNRTFVVAGGRFREPYYWDSYWI
LEGLLRTGGAFTEISKNTIENFLDFVENFGFVPNGARVYYLNRSQPPLLAQMVRLYVEYT
NDRSILDRAVPLLIKEHEFWTTNRTVEVRKDGNTYILSRYDVANTQPRPESYREDYTTAT
NSSYYSTSGIIYPEVETLNETEKARLYANLASGAESGWDYSSRWIARPADAKRDVYFPLR
SLNILETVPVDLNAIMYWNEITIAAFLTSTGNGTGAASWTQQAHKRSDAMYNLMWNSTLS
SYFDYNITAGAQNIFIPRDDDASDVETNTAGSEQQVVFSVAQFYPFWTGAAPDHLKNNPY
AVKEAFERVEKYLDNKKGGIPATNLVTGQQWDQPNVWPPLMHILMEGLRKTPATFGESDP
SWRDVQSLALRLGQRYLDSTFCTWYATGGSTSETPQLQGLSSQNVGTMFEKYGDNATNVA
GGGGEYEVVEGFGWTNGVLIWAVDVFGNDLKRPDCGNITAASVHPGKRSLPQRAVELNYY
DASWTKRFGRRALEAKDKS

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	51	624	2e-159	0.9918533604887984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	4.73e-134	51	627	3	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	3.79e-130	49	627	25	545	alpha,alpha-trehalase
224541	TreA	4.96e-86	33	632	53	558	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	2.93e-82	33	627	44	537	alpha,alpha-trehalase TreA.
183934	treF	2.47e-75	40	618	61	538	alpha,alpha-trehalase TreF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC80667.1|GH37	0.0	1	668	1000	1668
AAN38003.1|GH37	0.0	19	673	21	681
QBZ56021.1|GH37	0.0	19	673	21	681
AEO70020.1|GH37	0.0	7	677	8	685
AEO53147.1|GH37	0.0	7	677	7	684

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	4.02e-76	53	627	40	555	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	5.73e-75	53	627	40	555	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
2JG0_A	5.01e-61	39	640	15	514	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
5Z66_A	6.47e-61	33	624	46	537	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JF4_A	3.34e-58	39	640	15	514	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	1.12e-119	11	635	29	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|Q9JLT2|TREA_MOUSE	1.49e-106	30	630	24	551	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|Q8MMG9|TREA_PIMHY	4.12e-105	31	628	45	573	Trehalase OS=Pimpla hypochondriaca OX=135724 GN=tre1 PE=1 SV=1
sp|O43280|TREA_HUMAN	1.08e-104	30	630	27	554	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|A8J4S9|TREA_APIME	1.26e-104	22	634	32	576	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000218	0.999743	CS pos: 20-21. Pr: 0.9674

TMHMM  Annotations     

There is no transmembrane helices in EFQ29240.1.