CAZyme Information: EFQ28477.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ28477.1
• CAZy Family: CE16
• CAZyme Description: Glyco_trans_2-like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:E3QC89]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
903		101019.42	5.6456

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697341:244075-247019(-)

Full Sequence      

MKAFKSYFSPDQAPDNAAAGTSKPNTVQPPTPSPKLQSEKPAPYRNYSNRASARQSTVSL
ALTAGMRDKHASSINDLWADVTVHSLYQDQLRKMYASAWNLGEGCVLKKGRNEYVCAPPQ
LATIPNGFFDMVGQLNVSCAMTVNTPVIQSIIHGFLNSGEQTNSIPLSGGLQLQVLPRMT
DLPRCQKHHFAAYILDPPLLVVWDDDANKIHNRAESLEQMIIAHIWRSESADEEEDDEKN
EKQPGVGLEELSPAALEEALKTEARPTRVVSSALVALALGLSITCLGLGWRSLALEVAVD
GDYKRLGLVAVAPITLFISLFFFISISGVIFQVFGPISSINANSSNYSGKPPRRLSPYRQ
QLPHVTFQMPVYKEGLGAVIKPTVLSLKAAISTYEMQGGSATILVNDDGMQLIDPDEAVA
RREFYNEHSIGWVARPAHNPKPEDPAEAPFIRKGRFKKASNMNYALMTSNKLEDRLNQVD
RSSNWNQESEDQVYEQALAQIVEESGGRTWAGGNIRIGDYILLIDSDTRVPRDCLLDAVS
EMENSPEVAILQYTSGVMNVSDSFFEKAVTWFTEMIYTMITFNVANGDISPFVGHNAVLR
WSAIQDAASYMDEEDGYEKFWSESHVSEDFDMALRLQTAGYVIRYGAYTGDGFQEGVSLT
VYDELARWEKYAYGCNELLFHPLRFWLTRGPFTPLFRNFLTSNIAFFRKLTILSYIGTYY
AIGASWILTVLNYFLTGWFNGVYDKYYLDSFAIYFSIIIVFPLCGNVALGILRYRLGQQS
LIGAIWNNFKWMPIFSIFLGGISLHVSKALLCHFFEINIQWGATSKEVERCNFMEEIPKI
IKNFAGTFIYTFAATALIVCGIYVFPPQWQIHTFATIFPLGVSIVSHFALPVLLNPALMK
FTF

Enzyme Prediction     

No EC number prediction in EFQ28477.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	520	739	1.4e-51	0.9847715736040609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	1.92e-48	520	728	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	1.18e-15	313	814	4	422	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	7.53e-13	369	629	3	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133029	GT_2_like_c	2.84e-07	479	645	32	156	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
133043	CESA_CelA_like	7.44e-07	363	645	1	202	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC78319.1|GT0	0.0	1	903	34	935
AEO56958.1|GT0	0.0	67	902	114	955
EAA31611.3|GT0	0.0	52	902	33	876
AEO63469.1|GT0	0.0	67	902	141	980
VBB76138.1|GT0	0.0	1	902	1	940

PDB Hits     

EFQ28477.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q83Z42|OPGH_XANEU	1.42e-06	518	674	236	392	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas euvesicatoria OX=456327 GN=opgH PE=3 SV=1
sp|Q3BXV7|OPGH_XANC5	1.43e-06	518	674	236	392	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) OX=316273 GN=opgH PE=3 SV=1
sp|Q8PPR7|OPGH_XANAC	1.43e-06	518	674	236	392	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=opgH PE=3 SV=2
sp|Q2NYU0|OPGH_XANOM	2.47e-06	521	674	241	392	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) OX=342109 GN=opgH PE=3 SV=1
sp|B0RNI5|OPGH_XANCB	3.24e-06	518	674	236	392	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas campestris pv. campestris (strain B100) OX=509169 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000002

TMHMM  Annotations     

Start	End
272	294
309	331
713	735
750	772
844	866
876	898