CAZyme Information: EFQ28402.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ28402.1
• CAZy Family: CE12
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:E3QBR3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
833		90981.15	5.8689

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697340:975498-978145(+)

Full Sequence      

MADFDVEEVLKKLTVSEKVDLLAGIDFWHTKALPNHNIPSIRLSDGPNGVRGTKFFNGIK
AACFPCGTALGATFNTELLEEAGRKMGEEAKLKGAHCILGPTINMQRSPLGGRGFESIGE
DPVLAGLGSAAIVRGIESTGIQATPKHFVCNDQEHRRNAVHSIVTERALREIYALPFQLT
FRDSTPGALMTAYNGVNGTFCSENSDLLDKLVRKEWGWDGMIMSDWYGTYSTTEAANAGL
DLEMPGPPRFRGEPLKFNVSTDKVRQHVLDERARAMLKFIKKAVATGIPEGAPEKTGDTP
ETAELLRRIGGESIVLLKNDDNVLPLKKDKKTVVIGPNAKIATYHGGGSAALAAYYAVTP
FDGISKKLQSPPEYTEGAYSHKLLPLLGNVCKSADGKHGMTMRAYNEPPTDRHREFVDEL
VLTKTELLLVDYYNPKLKSNLWYADFEGSFVAEEDCAYELGLIVCGTANLFVNGKLVIDN
STSQRQGDAFFGAATVEEKGRVELKKGETYTFKVEFASAPSSKLQGGNVIFGGGALRIGG
CKVIDNKAEIAKAAALAKDADQVIICSGLNADWETEGNDRADMDLPGYLNKLISAVAQAN
PNTVVVNQSGTPVRMPWAKDVKALVQAWYGGNETGNAIADVLFGDVNPSAKLSLSFPERV
QDNPAYLNYRTEASRTLYGEDVYIGYRYYEYIDRPVLFPFGHGLSYTSFSFSGLKVTEKD
GKIAVNVNVKNTGKLQGAEVVQVYIAPKQKAKVNRPLKELKGFAKVFLAPEESKSVTVDI
ETKYAASYFDEERHQWCAEEGEYEVIVSDSSVLTDKAAKGSFQVGETFWWSGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	245	5.3e-59	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.81e-67	64	810	120	754	beta-glucosidase BglX.
224389	BglX	5.12e-61	26	341	48	366	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	8.43e-55	314	706	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	6.51e-40	13	779	60	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.37e-31	64	277	88	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC84651.1|GH3	0.0	1	833	1	833
QBZ56956.1|GH3	0.0	1	833	10	844
UKZ86562.1|GH3	0.0	1	833	1	836
UKZ67932.1|GH3	0.0	1	833	1	834
UPL03711.1|GH3	0.0	1	833	1	832

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.09e-278	1	833	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.92e-271	4	833	4	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.40e-133	5	827	4	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	9.43e-112	13	811	12	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.10e-97	6	826	4	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NDE2|BGLI_ASPFN	0.0	1	833	1	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q0CAF5|BGLI_ASPTN	0.0	1	833	1	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|A2R989|BGLI_ASPNC	0.0	22	833	1	818	Probable beta-glucosidase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	0.0	1	833	1	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	0.0	1	833	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999981	0.000065

TMHMM  Annotations     

There is no transmembrane helices in EFQ28402.1.