CAZyme Information: EFQ28360.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ28360.1
• CAZy Family: CE1
• CAZyme Description: Alpha-1,3-mannosyltransferase CMT1 [Source:UniProtKB/TrEMBL;Acc:E3QBM1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
475	GG697340|CGC5	52720.91	5.3653

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697340:807446-808959(+)

Full Sequence      

MARRKLIVVAQAIAVCLLLVSLLVAYDLFSGRDYFDAAYKPFRNSKTTAEAHGGSPHDGA
DQTNTTVALPVVTPSQTPLPGSTRTPTPTPPPVPPPPGGGDDTASALPDGDPEHLKNAPK
YIAAILDPDDKSMPRLDCPRPDTARYQYLKPSSALKRKPKYFIALNIRQKVELLPRLMGS
IVEALRFLGPENCVLSVVEGNSRDGTYEVLHLLRPELERLGTEYHFSRSDLDPGAGDRIP
KLAELRNMALAPLVADPARYAADAVVLFLNDVAACLEDILELAHQRLYLGADMTCAFDWT
YVGQDPTFYDVWISRTIAGDSFFEIPPDGNWNSAWNIFWNEQTSRRRLASHKPLQVFSCW
NGAVAITARPLLDRLVRFRAPGPGECFQGEPQLFCKDMWNAGFGKIAVVPSVNLEYSDEA
GRKIKAAKGYTSQWVGDEDKDDDFKVDWKADPPEKVKCMASYDKQTWEPWNQGLE

Enzyme Prediction     

No EC number prediction in EFQ28360.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	160	400	2e-70	0.99581589958159

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	6.50e-100	160	394	1	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC84687.1|GT69	2.14e-279	2	475	3	474
EAA28991.1|GT69	7.18e-159	117	472	89	452
AEO64631.1|GT69	3.49e-158	121	472	75	437
CAP61615.1|GT69	6.37e-157	126	471	1	349
CDP27968.1|GT69	6.37e-157	126	471	1	349

PDB Hits     

EFQ28360.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6U1Z4|CMT1_CRYNJ	5.44e-51	145	458	117	441	Alpha-1,3-mannosyltransferase CMT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.993019	0.006999

TMHMM  Annotations     

Start	End
7	29