CAZyme Information: EFQ27646.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ27646.1
• CAZy Family: AA9
• CAZyme Description: Alpha-1,4 glucan phosphorylase [Source:UniProtKB/TrEMBL;Acc:E3Q9V8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
887	GG697338|CGC4	100262.29	5.7495

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697338:389939-393079(-)

Full Sequence      

MSASTEPQRIPLRERRPSTGAPIIDIQGSVGPAGVSRPKHKRTFTGFGAGEIKSVEASIP
EPQREAWSKAQTSPFKSKEEFEKEVVRHVETTLARSMFNCDETAAYSAASLAFRDRLVKE
WNKTQQRQTTVDGKRIYYFSLEFLMGRALDNAMLNVGLKDVAKAGLDDLGFRIEDVIEQE
HDAALGNGGLGRLAACFLDSLASLNFPAWGYGLRYRYGIFKQEIIDGYQVEVPDYWLDFN
PWEFPRHDVTVDIQFFGHVQKSTDSNGKTVASWEGGETVTAVAYDVPIPGYATTSTNNLR
LWSSKAASGEFDFQKFNSGDYENSVADQQRAETISAVLYPNDNLERGKELRLKQQYFWCA
ASLYDIVRRFKKSRRPWREFPDQVAIQLNDTHPTLAIVELQRILVDLEKLDWDEAWNIVT
STFGYTNHTVLPEALEKWPVGLVQHLLPRHLQIIYDINLFFLQSVEKMFPNDRDILGRVS
IIEESQPKMVRMAFLAIVGSHKVNGVAELHSDLIKTTIFKDFVNIYGPDKFTNVTNGITP
RRWLHQANPRLSDLIASKTGGYGFLKDLTQLNKLELSVDDKAFRKEWAEIKYANKIRLAK
YIKSTTGVSVNPAALFDVQVKRIHEYKRQQMNIFGVIHRYLTLKAMSPEDRKKVAPRVSI
FGGKAAPGYWMAKQIIHLVNNVGSVVNKDEDIGDLLKVIFLEDYNVSKAEMIIPASDLSE
HISTAGTEASGTSNMKFVLNGGLIIGTCDGANIEITREIGENNIFLFGNLAEDVEDLRHA
HTYGTHSIDENLSKVFSAIESDTFGSVSDFQALISAVRDHGDYYLVSDDFNSYVETHNLV
DEAYKNQEEWITKSITSVARMGFFSSDRCINEYAEEIWNVEPLKVED

Enzyme Prediction     

EC	2.4.1.1:158

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	166	881	2.6e-281	0.9970326409495549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395272	Phosphorylase	0.0	166	880	1	661	Carbohydrate phosphorylase. The members of this family catalyze the formation of glucose 1-phosphate from one of the following polyglucoses; glycogen, starch, glucan or maltodextrin.
184948	PRK14986	0.0	107	885	43	815	glycogen phosphorylase; Provisional
223136	GlgP	0.0	76	882	4	750	Glucan phosphorylase [Carbohydrate transport and metabolism].
237881	PRK14985	0.0	127	878	52	794	maltodextrin phosphorylase; Provisional
273967	P_ylase	0.0	85	880	1	794	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC89442.1|GT35	0.0	1	887	1	887
VBB74050.1|GT35	0.0	8	886	4	882
CAP67393.1|GT35	0.0	8	886	4	882
CDP24807.1|GT35	0.0	8	886	4	882
AEO70908.1|GT35	0.0	8	886	4	882

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1YGP_A	0.0	38	883	1	878	Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae],1YGP_B Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae]
4BQE_A	3.88e-277	102	885	85	873	Arabidopsis thaliana Cytosolic Alpha-1,4-glucan Phosphorylase (PHS2) [Arabidopsis thaliana],4BQE_B Arabidopsis thaliana Cytosolic Alpha-1,4-glucan Phosphorylase (PHS2) [Arabidopsis thaliana],4BQF_A Arabidopsis thaliana cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with acarbose [Arabidopsis thaliana],4BQF_B Arabidopsis thaliana cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with acarbose [Arabidopsis thaliana],4BQI_A ARABIDOPSIS THALIANA cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with maltotriose [Arabidopsis thaliana],4BQI_B ARABIDOPSIS THALIANA cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with maltotriose [Arabidopsis thaliana]
2GJ4_A	3.44e-265	80	884	15	820	Structure of rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]
2GM9_A	3.56e-265	80	884	15	820	Structure of rabbit muscle glycogen phosphorylase in complex with thienopyrrole [Oryctolagus cuniculus],5MCB_A Glycogen phosphorylase in complex with chlorogenic acid. [Oryctolagus cuniculus],7ONF_A Chain A, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]
2FFR_A	3.56e-265	80	884	15	820	Crystallographic studies on N-azido-beta-D-glucopyranosylamine, an inhibitor of glycogen phosphorylase: comparison with N-acetyl-beta-D-glucopyranosylamine [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P06738|PHSG_YEAST	0.0	38	883	24	901	Glycogen phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPH1 PE=1 SV=4
sp|Q00766|PHS1_DICDI	8.69e-314	82	886	45	846	Glycogen phosphorylase 1 OS=Dictyostelium discoideum OX=44689 GN=glpV PE=1 SV=3
sp|P34114|PHS2_DICDI	1.50e-298	82	884	115	911	Glycogen phosphorylase 2 OS=Dictyostelium discoideum OX=44689 GN=glpD PE=1 SV=2
sp|P32811|PHSH_SOLTU	3.18e-279	88	885	33	837	Alpha-glucan phosphorylase, H isozyme OS=Solanum tuberosum OX=4113 PE=1 SV=1
sp|Q9SD76|PHS2_ARATH	6.51e-277	102	885	52	840	Alpha-glucan phosphorylase 2, cytosolic OS=Arabidopsis thaliana OX=3702 GN=PHS2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EFQ27646.1.