CAZyme Information: EFQ27378.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ27378.1
• CAZy Family: AA9
• CAZyme Description: Chitinase [Source:UniProtKB/TrEMBL;Acc:E3Q9J9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417	GG697337|CGC4	44234.12	4.2342

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697337:696714-698185(+)

Full Sequence      

MSFLKLSLAALLAAGASAAPVDEPYPPSGTAGGMVASSYFAGFHADEGFPVSSIPWEKYT
DVKYAFAETNPDGTLNLSKAAPDQIPGFVAAAHAHNVKALISLGGWTGSRFFSSAIATPE
NRTAFVKTALDLVAQYDLDGLDFDWEYPNRQGLGCNVINANDTANFALFLQELRQQQPKQ
LYLTAATSLFPWNDATGAASTNGALAPFAQSLDYLMVMGYDIYGAWASTGGPNAPLAFAC
DPRNNQGGIEEGVNKWIAAGIPAEKIALGVAAYGHSFSVNSTNAFTAPGVLNAYPPQNSS
NRLQGGSWDNDPPVDECGNPQPHSGTYTFSSMITEAMFLDTSGNPSAGIASGYDNCSQTP
FLYDEARQIWVSYDDVKSLGVKGQYIQSNKMAGFTMYETGGDYNNILLDAIRSGVGL

Enzyme Prediction     

No EC number prediction in EFQ27378.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	52	405	2.4e-65	0.8614864864864865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	9.86e-70	39	402	5	334	Glyco_18 domain.
119365	GH18_chitinase	2.17e-64	39	402	4	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
395573	Glyco_hydro_18	3.94e-61	39	402	5	307	Glycosyl hydrolases family 18.
225862	ChiA	9.46e-57	46	416	52	437	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119351	GH18_chitolectin_chitotriosidase	4.24e-50	60	393	29	332	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC81261.1|GH18	1.85e-220	1	417	1	414
UPK94240.1|GH18	7.97e-188	25	417	21	409
QBZ63682.1|GH18	1.47e-186	2	417	9	433
CEI61705.1|GH18	9.36e-173	12	417	17	411
QPC70652.1|GH18	1.54e-171	12	417	17	411

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	3.82e-52	53	412	16	366	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
1ITX_A	4.58e-38	96	413	122	417	Chain A, Glycosyl Hydrolase [Niallia circulans]
3FXY_A	1.02e-34	97	393	69	335	Acidic Mammalian Chinase, Catalytic Domain [Homo sapiens],3FXY_B Acidic Mammalian Chinase, Catalytic Domain [Homo sapiens],3FXY_C Acidic Mammalian Chinase, Catalytic Domain [Homo sapiens],3FXY_D Acidic Mammalian Chinase, Catalytic Domain [Homo sapiens],3FY1_A The Acidic Mammalian Chitinase catalytic domain in complex with methylallosamidin [Homo sapiens],3FY1_B The Acidic Mammalian Chitinase catalytic domain in complex with methylallosamidin [Homo sapiens],3RM4_A AMCase in complex with Compound 1 [Homo sapiens],3RM4_B AMCase in complex with Compound 1 [Homo sapiens],3RM8_A AMCase in complex with Compound 2 [Homo sapiens],3RM8_B AMCase in complex with Compound 2 [Homo sapiens],3RM9_A AMCase in complex with Compound 3 [Homo sapiens],3RM9_B AMCase in complex with Compound 3 [Homo sapiens],3RME_A AMCase in complex with Compound 5 [Homo sapiens],3RME_B AMCase in complex with Compound 5 [Homo sapiens]
2YBT_A	1.10e-34	97	393	73	339	Crystal structure of human acidic chitinase in complex with bisdionin C [Homo sapiens],2YBT_B Crystal structure of human acidic chitinase in complex with bisdionin C [Homo sapiens],2YBT_C Crystal structure of human acidic chitinase in complex with bisdionin C [Homo sapiens],2YBT_D Crystal structure of human acidic chitinase in complex with bisdionin C [Homo sapiens],2YBT_E Crystal structure of human acidic chitinase in complex with bisdionin C [Homo sapiens],2YBT_F Crystal structure of human acidic chitinase in complex with bisdionin C [Homo sapiens],2YBU_A Crystal structure of human acidic chitinase in complex with bisdionin F [Homo sapiens],2YBU_B Crystal structure of human acidic chitinase in complex with bisdionin F [Homo sapiens],2YBU_C Crystal structure of human acidic chitinase in complex with bisdionin F [Homo sapiens],2YBU_D Crystal structure of human acidic chitinase in complex with bisdionin F [Homo sapiens],2YBU_E Crystal structure of human acidic chitinase in complex with bisdionin F [Homo sapiens],2YBU_F Crystal structure of human acidic chitinase in complex with bisdionin F [Homo sapiens]
6JM7_A	6.87e-34	49	398	23	346	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	4.57e-36	96	413	154	449	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|Q9BZP6|CHIA_HUMAN	2.44e-33	97	393	90	356	Acidic mammalian chitinase OS=Homo sapiens OX=9606 GN=CHIA PE=1 SV=1
sp|C5P230|CHI1_COCP7	4.43e-33	13	416	17	399	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1
sp|Q1E3R8|CHI1_COCIM	4.43e-33	13	416	17	399	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1
sp|P0CB51|CHI1_COCPS	1.16e-32	13	416	17	399	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000259	0.999701	CS pos: 18-19. Pr: 0.9807

TMHMM  Annotations     

There is no transmembrane helices in EFQ27378.1.