CAZyme Information: EFQ27364.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ27364.1
• CAZy Family: AA9
• CAZyme Description: Glyco_transf_28 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:E3Q9I5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
914	GG697337|CGC2	100162.75	9.5118

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697337:655824-658701(-)

Full Sequence      

MSLSRVTSKGLGHIQLGSGDRSDTTTTGNVGNDGRVKVRFHENPQTLAAWFRNAQGAFRP
PSIDNSCREDDGGRVRRHSSVVFENLRQHPPAASPRLNIAIHIVGSRGDIQPFIPIAQLL
MQPPYGHRVRICTHPVFKEFVESNGVEFFSIGGDPEALMAYMVKNPGLLPSRESVKAGDI
GQRRKEMAEIINGAWRSCIEAGDGMGERTTAATVKDANHLFVADAIIANPPSMAHIHCAQ
KLGVPLHMVFTMPWCPTQAFHHPLASMSYGDADKSVANYLSFIMMELLTWQGLGDVINKF
RTQTLGLDHISPMWGCQLLPRLRVPYTFLWSESLIPKPKDWDSHINITGFSFLPLADKYT
PPPDLTAFLESGPPPVYIGFGSIVVDDPKALTQLIFKAVEIAGVRAIVSKGWGGVGGSHN
VPDDVYLIGNCPHDWLFKRVSAVVHHGGAGTSAAGIAAGRPTVVVPFFGDQPFWGQMIAR
AGAGPAPVPFKEMTAETLASSITFALKPEVQVAVQQMAQRIAEEDGAGDTARGIQERLAI
DTMRCDICPERLAVWRHKKTGAHLSGFAVTCLIDQGYMKPHEMKLLRQKHWYVDEGAESP
IIGLVAAAAGFFTAVGTATSDYSQRLRNPQPSMRVRETEIDFEDQLGQGKPAEGEINTTR
EASVEPSGEGEANPADGHAKKIERRSTMTPRQLKSLAMKMATKSLRCANPAAELALEDLT
KRGRRKKSVMSIGKRQRSRPMEITRATGRYGIEVAKAGLKAPVAVFYNVANGFHNFPSYG
FAGHDVRRRDEITGLGSGLRTAGKEFALGGWEAFSGVIVKPYKGAKNEGIKGFGKGTWQA
LRGFTYNIFAGLFGLPGYTLKGLEKELSKHRLTELRAEVMLIQLRRGMVDYRTSTEADRE
EVIVRWKEFLSARP

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	214	537	2.6e-57	0.7670157068062827

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.31e-81	97	527	1	394	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	8.06e-37	99	536	4	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.06e-16	99	260	1	138	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	4.41e-11	370	527	222	379	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
278624	UDPGT	3.86e-04	440	507	341	403	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAD00894.3|GT1	0.0	6	911	4	910
UQC81313.1|GH78|GT1	0.0	8	894	50	947
UPK91708.1|GT1	0.0	1	907	1	881
QKD55584.1|GT1	0.0	1	907	1	887
QGI82773.1|GT1	0.0	1	907	1	887

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	7.10e-69	104	538	27	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.17e-68	104	538	47	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
3H4I_A	2.18e-31	97	553	1	394	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1IIR_A	4.77e-31	97	532	1	392	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
1RRV_A	1.86e-23	97	531	1	392	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	2.08e-124	75	526	134	562	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	1.33e-120	95	538	191	610	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|A0A2Z4HPY4|EFUA_HORCR	1.46e-70	96	591	696	1181	Enfumafungin synthase efuA OS=Hormonema carpetanum OX=284138 GN=efuA PE=3 SV=1
sp|Q54IL5|UGT52_DICDI	5.82e-70	83	526	1150	1597	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|P0CN91|ATG26_CRYNB	4.21e-69	97	565	1034	1497	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EFQ27364.1.