CAZyme Information: EFQ27362.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ27362.1
• CAZy Family: AA9
• CAZyme Description: Endo-1,4-beta-xylanase [Source:UniProtKB/TrEMBL;Acc:E3Q9I3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
283		29396.04	8.4298

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697337:650514-651537(-)

Full Sequence      

MVSFTSVFVALTAFAGALAAPGELMKRQSTPSSTGTHNGFYYSWWTDGGSPVTYTNGPGG
QYSVVWQSGGNFVGGKGWNPGSARTITYSGTYQPNGNSYLAIYGWTRSPLIEYYIVENFG
TYNPSSGATKKGSVVSDGSTYDIYVSTRTNAPSIDGTRTFQQYWSVRQNKRVGGSVNTAT
HFNAWAQVGLNLGTHDYQIVATEGYFSSGSATITVGSSGSSPPPNTPPTTPPSTPPSGGG
GGGSGGSCAAKWGQCGGSGWTGATCCVSGSTCSAQNQWYSQCT

Enzyme Prediction     

EC	3.2.1.8:61

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	38	214	1e-74	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	3.87e-108	38	212	1	175	Glycosyl hydrolases family 11.
395595	CBM_1	5.01e-12	251	279	1	29	Fungal cellulose binding domain.
197593	fCBD	5.73e-12	250	282	1	33	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC81319.1|GH11	4.65e-135	1	218	11	228
AHE13929.1|CBM1|GH11|3.2.1.8	8.49e-134	1	282	1	281
CDP26454.1|CBM1|GH11|3.2.1.8	7.85e-131	1	282	1	286
VBB76545.1|CBM1|GH11	7.85e-131	1	282	1	286
CAP60973.1|CBM1|GH11|3.2.1.8	7.85e-131	1	282	1	286

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Y0H_A	1.60e-104	30	215	6	192	High resolution structure of GH11 xylanase from Nectria haematococca [Fusarium vanettenii 77-13-4]
5JRM_A	1.04e-100	22	215	1	192	Crystal Structure of a Xylanase at 1.56 Angstroem resolution [Fusarium oxysporum],5JRN_A Crystal Structure of a Xylanase in Complex with a Monosaccharide at 2.84 Angstroem resolution [Fusarium oxysporum f. sp. vasinfectum 25433]
5K7P_A	2.68e-95	28	215	1	189	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei]
1XNK_A	6.63e-95	30	218	4	193	Chain A, endoxylanase 11A [Thermochaetoides thermophila],1XNK_B Chain B, endoxylanase 11A [Thermochaetoides thermophila]
4XQD_A	7.41e-95	34	215	6	188	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4XQD_B Chain B, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],5ZF3_A Crystal Structures of Endo-beta-1,4-xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30],5ZH0_A Crystal Structures of Endo-beta-1,4-xylanase II [Trichoderma reesei RUT C-30],5ZO0_A Neutron structure of xylanase at pD5.4 [Trichoderma reesei RUT C-30]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B7SIW1|XYNB_PHACH	1.08e-112	1	282	1	289	Endo-1,4-beta-xylanase B OS=Phanerodontia chrysosporium OX=2822231 GN=xynB PE=1 SV=1
sp|Q06562|XYN1_COCCA	7.73e-111	1	215	1	218	Endo-1,4-beta-xylanase I OS=Cochliobolus carbonum OX=5017 GN=XYL1 PE=1 SV=1
sp|G4NA54|XYN4_MAGO7	5.31e-104	1	215	1	229	Endo-1,4-beta-xylanase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL4 PE=3 SV=1
sp|Q92245|XYN4_MAGGR	5.31e-104	1	215	1	229	Endo-1,4-beta-xylanase 4 OS=Magnaporthe grisea OX=148305 GN=XYL4 PE=3 SV=2
sp|B8NKE9|XYNA_ASPFN	6.36e-103	1	215	1	231	Probable endo-1,4-beta-xylanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=xlnA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000220	0.999738	CS pos: 27-28. Pr: 0.9479

TMHMM  Annotations     

There is no transmembrane helices in EFQ27362.1.