CAZyme Information: EFQ27141.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ27141.1
• CAZy Family: AA7
• CAZyme Description: CAP10 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:E3Q8C9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620		71516.69	7.2163

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697336:934404-936330(-)

Full Sequence      

MRRRQWTVVGLIAFLTICAYTIFRLPPEKRPIAVIPGSVKPPPPPQDPPKPAGDDAANGS
GPAPDRRPKPASGTGSHPMWHLMTGAEKDFQDTLKRQSKTLEDAVKEYRRRYGIPPPPHF
DKWFEFAKANGVQLVDEFDMINEMLTPFWGLKPATIRERAREALGFDNNLIGLLIRDQKI
SHIQGGQDWQRDATSGMIEKFIEYLPSMDLAFNIHDEPRVVVPHEDLTRLVSRAKDVNMP
KANAAVNPENAFTKRAGDLSEGNIIVEYKQTRFNVFAHQATWTHSRMSCPPDTPARGIDE
DELSDDRSRYGISELGFVYNITAMSDICLSPSLSSTYGFFDRPNAYNIVHDLFPIFSQSK
ISSYNDILYPSPWYWYKKVAYDESKDMPWEQKQDRLYWRGSTTGGFSRNGGWRRQHRQHF
VQKINAADQAKVYTNRGDEKNHKWEVKEVPRGDYRDIIDVYFSHVGQCDPGDCDAQKEFF
KVQGHAEQQDAWKYKYLLDMDGNAFSGRFYAFLQSRSLVFKFAIFREWHFEWLRPWAHYV
PLSLQGDDWLEAVRFFGDGALGRNEAERMAISSREWANKVLRKEDMEVWFFRLLLEYGRV
IDDKRDTIGFSVGASPQPPA

Enzyme Prediction     

No EC number prediction in EFQ27141.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	331	601	3.4e-81	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	3.39e-19	350	599	28	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	3.80e-10	354	599	108	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC78507.1|GT90	0.0	1	619	1	617
UNI14246.1|GT90	0.0	1	610	10	623
UKZ54826.1|GT90	1.53e-291	67	612	7	551
QLI64603.1|GT90	4.94e-291	1	615	1	646
QYT01287.1|GT90	5.37e-291	67	612	89	633

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	7.40e-08	331	601	95	342	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	6.16e-07	354	601	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	8.47e-55	76	606	151	661	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	3.70e-09	297	606	88	396	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|G3V9D0|PGLT1_RAT	1.40e-07	331	601	123	370	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	1.44e-07	354	606	163	395	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|Q6UW63|PLGT2_HUMAN	3.13e-07	485	600	353	466	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.544356	0.455654

TMHMM  Annotations     

Start	End
7	26