CAZyme Information: EFQ26514.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ26514.1
• CAZy Family: AA6
• CAZyme Description: Expansin-like EG45 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:E3Q6R6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244		25604.51	6.3670

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697334:1193590-1194324(-)

Full Sequence      

MKYHILLLAAAAAHVQSTPVGQVAPVASAETPATSPVLVTQNAVSSPTSGRSTFYGGNTS
GGKCSFSTYQIPSGLYGTAFSGQVWDSAAHCGACVKVTGPKGNSLVAMIVDECPECIESH
LDLFQDAFAQLGSLSGGIISTSYEFVNCGITSPIKLHNKSGTSAYWFSMQVLNHNEPLSA
LEVSTDGGSTWKKTTRQPYNFFENSSGFGTDSVDVRVTAESGKTVIVRNVSVKSDSEHNA
ASNF

Enzyme Prediction     

No EC number prediction in EFQ26514.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM63	157	226	1.1e-23	0.8589743589743589

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
409004	DPBB_RlpA_EXP_N-like	9.99e-26	48	145	1	94	double-psi beta-barrel fold of RlpA, N-terminal domain of expansins, and similar domains. The double-psi beta-barrel (DPBB) fold is found in a divergent group of proteins, including endolytic peptidoglycan transglycosylase RlpA (rare lipoprotein A), EG45-like domain containing proteins, kiwellins, Streptomyces papain inhibitor (SPI), and the N-terminal domain of plant and bacterial expansins. RlpA may work in tandem with amidases to degrade peptidoglycan (PG) in the division septum and lateral wall to facilitate daughter cell separation. An EG45-like domain containing protein from Arabidopsis thaliana, called plant natriuretic peptide A (AtPNP-A), functions in cell volume regulation. Kiwellin proteins comprise a widespread family of plant-defense proteins that target pathogenic bacterial/fungal effectors that down-regulate plant defense responses. SPI is a stress protein produced under hyperthermal stress conditions that serves as a glutamine and lysine donor substrate for microbial transglutaminase (MTG, EC 2.3.2.13) from Streptomycetes. Some expansin family proteins display cell wall loosening activity and are involved in cell expansion and other developmental events during which cell wall modification occurs.
409008	DPBB_EXP_N-like	5.40e-22	48	148	1	117	N-terminal double-psi beta-barrel fold domain of the expansin family and similar domains. The plant expansin family consists of four subfamilies, alpha-expansin (EXPA), beta-expansin (EXPB), expansin-like A (EXLA), and expansin-like B (EXLB). EXPA and EXPB display cell wall loosening activity and are involved in cell expansion and other developmental events during which cell wall modification occurs. EXPA proteins function more efficiently on dicotyledonous cell walls, whereas EXPB proteins exhibit specificity for the cell walls of monocotyledons. Expansins also affect environmental stress responses. Expansin family proteins contain an N-terminal domain (D1) homologous to the catalytic domain of glycoside hydrolase family 45 (GH45) proteins but with no hydrolytic activity, and a C-terminal domain (D2) homologous to group-2 grass pollen allergens. This family also includes GH45 endoglucanases from mollusks. This model represents the N-terminal domain of expansins and similar proteins, which adopts a double-psi beta-barrel (DPBB) fold.
226755	YoaJ	2.35e-20	15	226	4	207	Peptidoglycan-binding domain, expansin [Cell wall/membrane/envelope biogenesis].
409010	DPBB_SPI-like	1.89e-12	79	145	29	101	double-psi beta-barrel fold of Streptomyces papain inhibitor and similar proteins. Streptomyces papain inhibitor (SPI) adopts a rigid, thermo-resistant double-psi-beta-barrel (DPBB) fold that is stabilized by two cysteine bridges. SPI serves as a glutamine and lysine donor substrate for microbial transglutaminase (MTG, EC 2.3.2.13) from Streptomycetes, that is used to covalently and specifically link functional amines to glutamine donor sites of therapeutic proteins. SPI is a stress protein produced under hyperthermal stress conditions, and is able to inhibit the cysteine proteases, papain and bromelain, as well as the bovine serine protease trypsin.
178595	PLN03024	2.87e-11	35	143	9	123	Putative EG45-like domain containing protein 1; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC79876.1|CBM63	2.44e-115	50	244	126	320
CAK47858.1|CBM63	3.17e-89	44	244	323	523
BCS00460.1|CBM63	8.03e-89	49	244	324	519
BCS12235.1|CBM63	8.03e-89	49	244	324	519
BCS29837.1|CBM63	1.61e-88	49	243	179	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4JCW_A	3.27e-24	48	244	3	198	Crystal structure of Clavibacter michiganensis expansin in complex with cellopentaose [Clavibacter michiganensis subsp. michiganensis NCPPB 382],4JCW_B Crystal structure of Clavibacter michiganensis expansin in complex with cellopentaose [Clavibacter michiganensis subsp. michiganensis NCPPB 382],4JJO_A crystal structure of apo-clavibacter Michiganensis expansin [Clavibacter michiganensis]
4JS7_A	1.76e-23	48	244	3	198	Crystal structure of D78N mutant apo form of clavibacter michiganensis expansin [Clavibacter michiganensis subsp. michiganensis NCPPB 382],4L48_A Crystal structure of d78n mutant clavibacter michiganensis expansin in complex with cellohexaose [Clavibacter michiganensis subsp. michiganensis NCPPB 382],4L48_C Crystal structure of d78n mutant clavibacter michiganensis expansin in complex with cellohexaose [Clavibacter michiganensis subsp. michiganensis NCPPB 382]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7G6Z2|EXP12_ORYSJ	1.27e-08	53	231	30	233	Expansin-A12 OS=Oryza sativa subsp. japonica OX=39947 GN=EXPA12 PE=2 SV=1
sp|Q54C78|EXPL9_DICDI	2.64e-08	61	210	49	208	Expansin-like protein 9 OS=Dictyostelium discoideum OX=44689 GN=expl9 PE=3 SV=1
sp|Q2QP13|EXP26_ORYSJ	3.37e-07	50	165	85	207	Expansin-A26 OS=Oryza sativa subsp. japonica OX=39947 GN=EXPA26 PE=2 SV=1
sp|Q9M0C2|EGC1_ARATH	6.32e-07	35	143	9	121	Putative EG45-like domain containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=EGC1 PE=3 SV=1
sp|Q54J35|EXPL7_DICDI	5.39e-06	62	183	42	169	Expansin-like protein 7 OS=Dictyostelium discoideum OX=44689 GN=expl7 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000338	0.999650	CS pos: 17-18. Pr: 0.9706

TMHMM  Annotations     

There is no transmembrane helices in EFQ26514.1.