CAZyme Information: EFQ26005.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ26005.1
• CAZy Family: AA3
• CAZyme Description: Fibronectin type-III domain-containing protein [Source:UniProtKB/TrEMBL;Acc:E3Q4J0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	GG697333|CGC4	40818.75	4.8911

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697333:822440-823546(+)

Full Sequence      

MGDCIDDDVSPPIRVMIVGDSMTQGREGDFTWRYRLWQWMTAEGVNFQFVGPYKGTKTPE
VSRPTHPPASDTEPTLDSNVPVDLGGYAAGVRFDSCHFSVWGLQATQCNELVQDQVERFR
PDYMLVMLGFNDMGWGVADAKGTIVAMEQLINRTRAANPTAKLAIADVPQRTPMEGTEKL
APMVDRYNQLLRTSARNWGTQQSPIELVEIRDNYDCSHGSYDGLHPNALGEFQIARAFSR
SLVRGYSIGTHELSIPLKIPERPTPVPANIVAEAVAYGVAVTWDAVYGALGYDVRSREGT
GSLWIESRTESNRCDSTCTQEGLEYHYQVRTYNGDSLVSAWSKVVSAMSRQSRVLDSGTL
AQDKMQNG

Enzyme Prediction     

No EC number prediction in EFQ26005.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	13	241	4.6e-50	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.23e-36	97	242	17	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.93e-15	114	230	55	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238872	SGNH_hydrolase_like_2	5.30e-10	100	241	46	191	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	1.82e-08	88	238	31	184	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
225353	TesA	2.29e-08	95	237	57	203	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCG40251.1|CE0	2.89e-104	13	348	336	677
UKZ09962.1|CE0	2.13e-95	8	349	507	855
BAE63679.1|CE0	7.94e-75	9	269	53	317
CAK39824.1|CE0	9.35e-74	13	269	139	394
AVT40037.1|CE0	4.95e-61	15	347	345	673

PDB Hits     

EFQ26005.1 has no PDB hit.

Swiss-Prot Hits     

EFQ26005.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EFQ26005.1.