CAZyme Information: EFQ25962.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ25962.1
• CAZy Family: AA3
• CAZyme Description: Glucanase [Source:UniProtKB/TrEMBL;Acc:E3Q5J5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344		37452.48	9.6860

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697333:666158-667297(+)

Full Sequence      

MHFASVIALLSALGTVSASPRHGIRSQCVGRATASTHPFEGRKLYANPEWAQKLEITHKS
FLNKGDTTNAGKVRTIQNIGTFVWVSNTAMLADIDTAIKGARAAQAKTGQKQTVGLVLYN
LPDRDCSAGESAGESSVDKNGLQLYKDTFIKPYTEKLAAATDLHFAVILERDALANAVMS
TVVGNVRLSRKPLADCDQCRTSRSVPRPRRRTRMVSLMPSQACMQYDHVSLYIGAANGGW
LGWDSNLGPAAEEFSKVVKVAGKNAMIRGFSTNVSNYNPLFANQPLSYARGSKSYDESHY
ALSLAPHLEANSLPSQFIIDQGRISYSRKDWGEWCNVSPAGFGM

Enzyme Prediction     

EC	3.2.1.91:55	3.2.1.4:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	57	344	1.7e-51	0.8639455782312925

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	9.84e-96	66	344	1	260	Glycosyl hydrolases family 6.
227616	CelA1	8.79e-18	8	344	3	362	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC84245.1|GH6	3.14e-138	1	344	105	431
QBZ59948.1|GH6	9.34e-118	1	344	36	362
CAD71092.1|GH6	2.95e-113	1	343	1	322
AKI05479.1|GH6	1.15e-112	1	343	1	323
AGV05123.1|GH6	1.53e-112	1	343	1	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1DYS_A	2.15e-92	35	344	2	292	Endoglucanase CEL6B from Humicola insolens [Humicola insolens],1DYS_B Endoglucanase CEL6B from Humicola insolens [Humicola insolens]
3A64_A	8.27e-65	31	344	8	307	Chain A, Cellobiohydrolase [Coprinopsis cinerea],3A9B_A Chain A, Cellobiohydrolase [Coprinopsis cinerea],3ABX_A Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOF_A	1.28e-63	31	344	8	307	Chain A, Cellobiohydrolase [Coprinopsis cinerea]
5XCY_A	5.08e-56	34	343	1	288	Chain A, Glucanase [Phanerodontia chrysosporium],5XCZ_A Chain A, Glucanase [Phanerodontia chrysosporium]
3VOG_A	4.09e-55	37	344	8	293	Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOH_A Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOI_A Chain A, Cellobiohydrolase [Coprinopsis cinerea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2AC20|CEL6B_PODAN	6.37e-100	36	343	63	356	1,4-beta-D-glucan cellobiohydrolase CEL6B OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=CEL6B PE=1 SV=1
sp|B2ADA5|GH6D_PODAN	2.22e-97	5	344	3	310	Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=GH6D PE=3 SV=1
sp|Q7SIG5|GUN6_HUMIN	1.11e-91	35	344	2	292	Endoglucanase-6B OS=Humicola insolens OX=34413 GN=cel6B PE=1 SV=1
sp|P49075|GUX3_AGABI	3.54e-48	37	344	90	369	Exoglucanase 3 OS=Agaricus bisporus OX=5341 GN=cel3 PE=1 SV=1
sp|Q9C1S9|GUX6_HUMIN	2.83e-47	32	344	113	407	Exoglucanase-6A OS=Humicola insolens OX=34413 GN=cel6A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000324	0.999656	CS pos: 18-19. Pr: 0.9830

TMHMM  Annotations     

There is no transmembrane helices in EFQ25962.1.