CAZyme Information: EFQ25926.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ25926.1
• CAZy Family: AA3
• CAZyme Description: FAD-binding PCMH-type domain-containing protein [Source:UniProtKB/TrEMBL;Acc:E3Q5F9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493	GG697333|CGC6	53665.34	5.7344

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697333:548402-550051(+)

Full Sequence      

MVTRIAFLAAILAASASPLTRKAIIDDCLAAAEVPYNEKDSSQWVADAAPFNVRIPFVPV
SIAAPLTTEHIQAAVKCGRDNGVKVTPKSGGHSYANFGFGGEDGHLVLELDRMYNVTLNN
ATGIATVQAGSRLGHVATELYKQGGKAISHGTCPGVGVGGHVLHGGYGMSAHTKGLALDW
LVGAKVVLANSTVINVSESEHPGVFWALKGAGSSFGVVSEFYFKTFDAPKQATNFAVALQ
WDSEKAVDGFKKLQAWAETTMPNELNMRLAISSFSTTLEGMFYGNKTGLQAALNPLLATI
GGRLTTSQTTDWLGHLQHFGNGMALDQKDNYKLQENFHSSSLYTDKLSDAQVESFVDYWY
TVGKSMRRFWWIQVDLHGGKNSAISQIAENSSAYAYRSKLLLYQFYDLVALSATYPEDGF
SFLDQFIANTTVGMEQGARGMYFSYPDANMDQDRAQVEYWGSNVARLQEIKEEVDPEEVF
YLPQSVRPASSAD

Enzyme Prediction     

EC	1.1.3.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	49	486	4.7e-87	0.9890829694323144

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	3.58e-21	56	480	29	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	1.14e-18	62	197	4	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
369658	BBE	2.14e-10	442	487	2	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ54840.1|AA7	3.33e-189	2	489	4	496
VBB75481.1|AA7	5.89e-178	16	492	19	496
AEO63154.1|AA7	6.56e-178	19	489	22	492
CAP73004.1|AA7	2.38e-177	16	492	19	496
CDP25404.1|AA7	2.38e-177	16	492	19	496

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	1.21e-162	10	489	12	495	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
1ZR6_A	1.14e-151	25	488	9	478	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
3HSU_A	2.60e-150	25	488	9	478	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]
6Y0R_AAA	4.94e-145	15	488	18	490	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
6YJO_A	1.69e-134	23	491	33	506	Chain A, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QG48|XYLO_MYCTT	6.24e-162	10	489	12	495	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|Q6PW77|GOOX_SARSR	1.80e-151	16	488	19	497	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1
sp|I1S2K2|CHITO_GIBZE	2.54e-144	15	488	18	490	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	5.74e-133	4	488	2	493	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2
sp|E9F5F1|SUBF_METRA	6.51e-130	28	490	32	493	FAD-linked oxidoreductase subF OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=subF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000664	0.999286	CS pos: 21-22. Pr: 0.7824

TMHMM  Annotations     

There is no transmembrane helices in EFQ25926.1.