CAZyme Information: EFQ25918.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ25918.1
• CAZy Family: AA3
• CAZyme Description: GMC_OxRdtase_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:E3Q5F1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
786	GG697333|CGC5	83266.15	9.8525

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697333:518650-521085(-)

Full Sequence      

MRSILSGAAALLGLAGTAAAQLRASAYTDPQTGIDFQRFKPGSYPFSFGIAVPETIGTDF
IGQMVVPISETGNWGSVSLNGGMLNSLLFVAWADGKDIRTSFRVASAYANPSVYDETKVS
AVPIANGTFSPILGWAISNASPSPASDPGATLNYHSAGFGEFGLDIAEPKSAKFQTWSKY
AKAVGASPVPGNGTATPGAGNSTIPAPTTSNTTYDVIVVGGGPAGIIAAERLAEKGVSVL
FIERGVANAVHLGSKLALPWNNTLTPYDVPGVADVMTTLPGVSFCSDTASTAGCVLGGSS
SINGLNFIHPPDRDFERWPAGWNWKDISAAASRLYERNPGTTSPSSDKKYYDDLTFSILS
RLLQAKGWTQVDSIASPNEKDAVFSRPSFSIKNRLRAGPARTYMPFAQGLPNFTLKLGTK
VVQVIRSGSKVTGVLVQAADGSRQVIKLNQGGKVVLAAGALSTPRVLWNSGISRSDALEI
VKSGAATTGVTLPNKADWIDLPVGHSLRDHAQILLKFNSKSNFTAYPFSDIVSNPIKSDL
ELFQHGSGLIVQGDQRIHLWTSAKGADGRTRYLQGTASVMVNAVFYLRTFLTHGTSSVGE
LSITASGNTLIKTKPWLVDAEDRKTMSNFVQYWLDLAGAANSTISYVTPSATPTDIIDTQ
IISGDHWVGTTKMGTDHGRKNNGTAVVDLDAKVYGTDNLFVVDASIHPDLPTGNTQAIIM
VAAEHAAEKIAAVTVPGTNPDASKNSGGCAKRSTRRAMRSRRSARLHWMIGPRALSGHVR
VFRRGW

Enzyme Prediction     

EC	1.1.99.18:13	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	206	733	6.9e-196	0.9817518248175182
AA8	27	124	9.5e-30	0.5384615384615384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.02e-46	207	732	1	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
406418	CDH-cyt	1.36e-40	27	173	1	177	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
187688	CDH_like_cytochrome	1.21e-32	26	165	1	167	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
274888	Rv0697	1.21e-31	215	728	2	484	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
235000	PRK02106	4.39e-24	209	730	1	531	choline dehydrogenase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC84151.1|AA3_1|AA8	0.0	1	767	1	795
QKD53637.1|AA3_1|AA8	0.0	1	739	1	758
QGI78425.1|AA3_1|AA8	0.0	1	739	1	758
QGI92142.1|AA3_1|AA8	0.0	1	739	1	758
UPK95325.1|AA3_1|AA8	0.0	1	762	1	798

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	1.66e-122	27	732	7	765	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4QI6_A	3.59e-115	27	733	8	767	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
1KDG_A	2.85e-100	207	733	1	542	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]
4QI4_A	6.32e-99	207	733	1	545	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
1NAA_A	1.01e-98	212	733	1	537	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	1.63e-124	10	733	8	769	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|Q9VY01|EO_DROME	9.61e-24	214	730	90	643	Ecdysone oxidase OS=Drosophila melanogaster OX=7227 GN=Eo PE=1 SV=2
sp|Q988C9|4PADH_RHILO	9.63e-23	214	731	7	534	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q7MF12|BETA_VIBVY	3.20e-21	214	730	5	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q8D3K2|BETA_VIBVU	3.08e-20	214	730	5	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000608	0.999359	CS pos: 20-21. Pr: 0.9598

TMHMM  Annotations     

There is no transmembrane helices in EFQ25918.1.