CAZyme Information: EFQ25669.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ25669.1
• CAZy Family: AA2
• CAZyme Description: Peroxidase [Source:UniProtKB/TrEMBL;Acc:E3Q3R7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312		32099.83	4.4238

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697332:1299219-1300460(+)

Full Sequence      

MRATTLVLAGLLAATAAAVALPGSSEDASSSSVRGLEARGPECPEVWAQVNAELNGLFLD
DGGRCTALARGAIRALFHDCGTWDESQGQSGGCDGSLLIAADPDVELDRIENRGLPAVAG
TLRDLAAKYNTTAADMVVFAGNAAIFLCPGGPKVTTYIGRADSTKSAKAGGLPSPFDPPE
TLLGLFKAKGLDAEALAALLGAHSTSTQSFVNASQAGAPQDSTPGEMDVAYYKQTHDFAT
SGAGAAPAGIFVFPSDAGVATSEADSVGRWFQSFIGEQEKWSESFKKSMDRMSLFGNDKS
SMSDCTGSIAKL

Enzyme Prediction     

No EC number prediction in EFQ25669.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	50	297	4.5e-53	0.9803921568627451

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173826	ligninase	1.96e-64	46	309	16	287	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.
173823	plant_peroxidase_like	3.03e-19	60	293	9	254	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	1.27e-16	50	204	1	150	Peroxidase.
173827	secretory_peroxidase	3.78e-12	43	293	11	279	Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites.
173829	plant_peroxidase_like_1	2.24e-08	73	186	46	151	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS45858.1|AA2	1.56e-102	42	309	39	299
QDS74803.1|AA2	2.61e-76	43	311	40	292
QRD03396.1|AA2	7.07e-73	11	311	8	296
QDS68272.1|AA2	3.38e-56	42	309	151	403
QDS77202.1|AA2	4.57e-54	40	309	28	286

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ABQ_A	9.19e-27	59	306	28	279	CRYSTAL STRUCTURE ANALYSIS OF FUNGAL VERSATILE PEROXIDASE FROM PLEUROTUS ERYNGII. MUTANT VPi-SS. MUTATED RESIDUES T2K, A49C, A61C, D69S, T70D, S86E, A131K, D146T, Q202L, Q219K, H232E, Q239R, L288R, S301K, A308R,A309K AND A314R. [Pleurotus eryngii]
6ISS_A	4.60e-26	62	306	38	293	Chain A, Ligninase H8 [Phanerochaete chrysosporium RP-78],6ISS_G Chain G, Ligninase H8 [Phanerochaete chrysosporium RP-78]
1QPA_A	1.11e-25	62	306	32	287	Chain A, Lignin Peroxidase [Phanerodontia chrysosporium],1QPA_B Chain B, Lignin Peroxidase [Phanerodontia chrysosporium]
5FNB_A	6.29e-25	59	306	28	279	Crystal Structure Of Fungal Versatile Peroxidase From Pleurotus Eryngii Septuple Mutant E37k, H39r, V160a, T184m, Q202l, D213a & G330r [Pleurotus eryngii],5FNB_B Crystal Structure Of Fungal Versatile Peroxidase From Pleurotus Eryngii Septuple Mutant E37k, H39r, V160a, T184m, Q202l, D213a & G330r [Pleurotus eryngii]
2VKA_A	1.85e-24	59	306	28	279	Site-Directed Mutagenesis of the Catalytic Tryptophan Environment in Pleurotus eryngii Versatile Peroxidase [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P11542|LIG4_PHACH	6.04e-25	62	306	60	315	Ligninase H2 OS=Phanerodontia chrysosporium OX=2822231 GN=GLG4 PE=1 SV=2
sp|Q96TS6|PEM3_PHLRA	4.73e-23	59	306	52	310	Manganese peroxidase 3 OS=Phlebia radiata OX=5308 GN=mnp3 PE=2 SV=1
sp|Q9UR19|VPL1_PLEER	6.43e-23	59	306	58	309	Versatile peroxidase VPL1 OS=Pleurotus eryngii OX=5323 GN=vpl1 PE=1 SV=1
sp|O94753|VPL2_PLEER	1.22e-22	59	306	58	309	Versatile peroxidase VPL2 OS=Pleurotus eryngii OX=5323 GN=vpl2 PE=1 SV=1
sp|P06181|LIG8_PHACH	2.62e-22	62	306	59	314	Ligninase H8 OS=Phanerodontia chrysosporium OX=2822231 GN=LPOA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000260	0.999700	CS pos: 20-21. Pr: 0.9487

TMHMM  Annotations     

There is no transmembrane helices in EFQ25669.1.