CAZyme Information: EFQ25106.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ25106.1
• CAZy Family: AA1
• CAZyme Description: Chitin synthase [Source:UniProtKB/TrEMBL;Acc:E3Q205]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
666		74697.57	9.8840

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697331:961482-963482(-)

Full Sequence      

MTRPEISRPIAVHTEDKRWTVKTLSPQLDTRPSSTHPPSHISRPGTPNSWRSQGEWDTYS
AASDSRPTTARSSFSSRYTNGNPKRKTGASGLGQDDGFVEKPSKFVTEYGWPILPDPSNP
GKKLTPRQLTTQRIFFILLVTILNISLAAIACFGNVGLATLVFILFVKCKDFVSSVLSLI
CLTGTSIYYHFRPPAPVSQRWILSLIPAYSESEEQLIKTVYSLRDNGCDPHRQVMCIVLD
GKPRNIKSEFSRIVADFERPYHSLKYKKSDLKITAGFMQDVPVIVIEKVKNSGKKDSLVL
THDLFNAPRENMPTYTRLLRQEIWGTILPQLTEGTNFRAFDMVFCTDADSVIHKGCVAKL
ANALARDKNAIATCGLVLVELEPGFEWSFWNLYQQLQYTFGQFVRRRAEGFIGKVTCLPG
CVTMIAVRKEMAGAIAKYARPVKADWVVHHQVQNLGTDRRLTYCMLSQDKKLRTIFVPDA
VSETVAPQSFKHYVHQRRRWGSNAYFNNYFYCAGENMILITRIAAAIDIARQTLVYYRVL
NTVLFIRALVTAFSIWDILPLLVVGQFPVIWFCICLAVEPSLRQRAHKIVLGFFVNKLVS
PFMSIIIFSAVAMNLGNAVWGMSGVTASSVPATPAKDELSKAEEGKGGVQRPQSPISRPP
SPPEVL

Enzyme Prediction     

No EC number prediction in EFQ25106.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	288	570	1.1e-25	0.5294117647058824

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367353	Chitin_synth_2	5.62e-28	202	578	27	441	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133033	Chitin_synth_C	1.88e-26	343	507	77	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
133045	CESA_like	5.38e-12	205	430	2	164	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	5.84e-12	341	622	139	405	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
404520	Glyco_tranf_2_3	5.03e-05	339	500	87	227	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC77280.1|GT2	0.0	1	666	1	670
UPK89963.1|GT2	1.31e-253	102	646	42	600
CEI61656.1|GT2	3.23e-248	111	649	167	717
CZS81212.1|GT2	3.00e-245	106	653	159	727
SCB65760.1|GT2	5.04e-245	106	641	164	702

PDB Hits     

EFQ25106.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13395|CHS6_USTMA	2.54e-22	200	507	407	742	Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS6 PE=3 SV=2
sp|J9VNT4|CHS5_CRYNH	6.50e-21	195	507	1247	1588	Chitin synthase 5 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS5 PE=2 SV=1
sp|Q4P9K9|CHS8_USTMA	8.66e-21	200	507	1265	1600	Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS8 PE=3 SV=1
sp|J9VF17|CHS4_CRYNH	2.95e-20	200	507	506	841	Chitin synthase 4 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS4 PE=2 SV=2
sp|O13394|CHS5_USTMA	6.13e-18	203	507	801	1149	Chitin synthase 5 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS5 PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

Start	End
135	157
172	191
534	556
560	582
589	611