CAZyme Information: EFQ25081.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ25081.1
• CAZy Family: AA1
• CAZyme Description: FAD binding domain-containing protein [Source:UniProtKB/TrEMBL;Acc:E3Q1Y0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454		49171.30	6.2328

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697331:832590-833985(+)

Full Sequence      

MDSKHFLRRFFVASLLCLTSAHILDQSNSKASELQTCLTTAGVRNAISTDDTWANDTAGF
QKRIKVDPAAISFPENNDQIALSLDCARNASTSASVLGAAHSFQAYAWLPSTLSLDAATN
RLTYGGGFHVGPVLKYLWDKHGRHFPHVRGANVGLAGSSIGGGFGSTSRHLGIPMDNLKS
VEYMLYNVTIVNAPKGSDIFWAAQGAGASFGVLLSVITNTYKPVFDTAVNFTINAGDLTS
TKAVKSLIAIQRYSLSKDCTDELALRWSLSGPPYMANGFFYGDAAGFDTVIAPLLRSLND
IAGSVTVQKTELPFWDMEVAVAGAGMNQPNESALSGRSFYTQSLTTTTDRPLTVEQAKVL
YESTSFSFNRTDMRKSGFIDLWGDVSRDISDTDTSFAHGKNLWLIRWDFNSVDVNSYPAD
GPAYMKSLIKPFEEALVASGAPLRGFVNYADTEL

Enzyme Prediction     

EC	1.1.3.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	58	244	4.5e-31	0.42358078602620086

CDD Domains     

EFQ25081.1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC77503.1|AA7	7.33e-252	1	454	1	465
UPK92823.1|AA7	7.29e-206	1	454	1	461
QPC70090.1|AA7	1.65e-194	1	454	1	459
QPC58687.1|AA7	3.33e-194	1	454	1	459
CEI61048.1|AA7	2.71e-193	1	454	1	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YJI_A	9.03e-195	27	454	3	439	Chain A, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1],6YJI_B Chain B, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1]
5K8E_A	9.72e-30	28	454	21	456	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
6Y0R_AAA	1.48e-28	29	454	22	452	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
6EO4_A	1.74e-19	31	417	11	411	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
6EO5_A	7.50e-19	31	417	11	411	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QG48|XYLO_MYCTT	5.00e-29	28	454	21	456	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|I1S2K2|CHITO_GIBZE	7.62e-28	29	454	22	452	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|P9WEY2|DPMAF_METAN	1.20e-21	21	423	16	424	FAD-linked oxidoreductase dpmaF OS=Metarhizium anisopliae OX=5530 GN=dpmaF PE=1 SV=1
sp|E9F5F1|SUBF_METRA	2.90e-21	21	423	16	424	FAD-linked oxidoreductase subF OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=subF PE=3 SV=1
sp|G3XMD0|AZAL_ASPNA	2.90e-13	111	222	115	224	FAD-linked oxidoreductase azaL OS=Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) OX=380704 GN=azaL PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.072429	0.927547	CS pos: 21-22. Pr: 0.5286

TMHMM  Annotations     

There is no transmembrane helices in EFQ25081.1.