CAZyme Information: EFQ24878.1

Basic Information

• Species: Colletotrichum graminicola
• Lineage: Ascomycota; Sordariomycetes; ; Glomerellaceae; Colletotrichum; Colletotrichum graminicola
• CAZyme ID: EFQ24878.1
• CAZy Family: AA1
• CAZyme Description: Mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:E3Q2P9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
516	GG697331|CGC4	59070.26	9.6692

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgraminicolaM1-001	12400	645133	380	12020

• Gene Location: location=GG697331:93821-95642(-)

Full Sequence      

MWRRTYLFLVLIRLWFALSPSYLHPDENFQGPEVIAGQIFSYPVRHTWEFTNEHPIRSVF
PLWPVYGLPMLLLRWLWIGNGKDGEIPPIAVFWTLRVLMFATSFVLEDWAIHELISSPRH
RRVAVLLVASSYVTWTYQTHTFSNSVECLVVAWCLVLIQRIVESPQQSSLLASSILGVVA
VFGLFNRITFPAFLLIPGLRLIPHFLNRPVSFIVMALAGLTTTFVAITLDTAFYLSEPIK
WTDLISRPVITPLNNLLYNIDTNNLAQHGLHPWYQHLLVNIPMLIGPAAVLLFTQPHISL
RLYSAISGVFVLSIFQHQEARFLLPTVPLILSSVHMPRSRTLLRVWIGAWIVFNLFFGIL
MGIYHQGGVVPGQVFLSKQPDATQAVWWKTYTPPIWLLNGKNEVLTTRDVMGMKGDTLLE
ELTKLATCDTPADRRNSEYLKEKNGTYLMAPASATWIDPYIPNKGLKGLRFREVWRYRQH
LNLDDLDFGDDGIWNTLARVIGRRGLVAWRVTKSCK

Enzyme Prediction     

EC	2.4.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	5	397	2.8e-79	0.9897172236503856

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	1.46e-48	5	396	2	410	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC77828.1|GT22	0.0	1	516	1	516
QLI65346.1|GT22	0.0	1	516	1	516
UNI14407.1|GT22	0.0	1	515	1	515
QPH02021.1|GT22	0.0	1	515	1	515
UPK89852.1|GT22	0.0	1	515	1	515

PDB Hits     

EFQ24878.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I785|SMP3_GIBZE	1.96e-318	1	515	1	515	GPI mannosyltransferase 4 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=SMP3 PE=3 SV=2
sp|Q2UTP0|SMP3_ASPOR	7.14e-181	1	514	1	540	GPI mannosyltransferase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=smp3 PE=3 SV=1
sp|Q4WTT7|SMP3_ASPFU	4.33e-178	1	514	1	544	GPI mannosyltransferase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=smp3 PE=3 SV=2
sp|Q5BAX7|SMP3_EMENI	2.53e-174	1	509	1	534	GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=smp3 PE=3 SV=2
sp|Q6CDD0|SMP3_YARLI	4.96e-103	10	487	13	495	GPI mannosyltransferase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=SMP3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.014394	0.985587	CS pos: 23-24. Pr: 0.5511

TMHMM  Annotations     

Start	End
140	162
177	199
212	234
272	294
342	364