CAZyme Information: EEU47645.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU47645.1
• CAZy Family: GT4
• CAZyme Description: Alpha-galactosidase [Source:UniProtKB/TrEMBL;Acc:C7YJY3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317	GG698896|CGC7	35222.51	4.5856

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698896:81548-82611(+)

Full Sequence      

MVAFSRIAVTTLALGGSTAQAKPATAARATGLADFKPGVQWEICIHHPIKHDSAADLIPT
KAKVWDIDMGHAQEFPNMIPMLKSAGKFVICYFNAGALQDWDDDKSKFPKEVIGHSLSYP
YDSEEWYLDIRDSRVLELQKARLDIAAKIGCDAVDPDNVDAWQQDDEDPTGFKLKSSDYT
NYLKNLAKYAHSIKTKDGQPLLVGQKNAPEIAEDLVSTLDFAVLESCRGNSDPNEESWPF
CEDFQTYIDAGKPVLQIEYPPSVEKTGKVSASDNKYYCTAEDEDKGFSKIIKWASAQLDG
WGQYCGEEPFRTPAAKY

Enzyme Prediction     

No EC number prediction in EEU47645.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	58	259	4e-51	0.9421052631578948

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397552	Glyco_hydro_114	2.15e-70	41	292	2	215	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
226386	COG3868	9.85e-13	1	263	40	270	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
225219	COG2342	6.06e-06	82	284	69	283	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK97753.1|GH114	5.92e-232	1	317	1	317
QKD47958.1|GH114	5.95e-198	1	313	1	315
QGI89288.1|GH114	1.54e-190	1	313	1	331
QGI58377.1|GH114	1.54e-190	1	313	1	331
CCT61950.1|GH114	1.54e-190	1	313	1	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6OJ1_A	1.19e-33	38	305	39	277	Crystal Structure of Aspergillus fumigatus Ega3 [Aspergillus fumigatus Af293]
6OJB_A	1.74e-33	38	305	56	294	Crystal Structure of Aspergillus fumigatus Ega3 complex with galactosamine [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

EEU47645.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000799	0.999183	CS pos: 21-22. Pr: 0.9785

TMHMM  Annotations     

There is no transmembrane helices in EEU47645.1.