CAZyme Information: EEU47403.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU47403.1
• CAZy Family: GT39
• CAZyme Description: GMC_OxRdtase_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:C7YM73]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574	GG698897|CGC8	62863.77	6.3671

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698897:1691758-1693804(-)

Full Sequence      

MAPDSAYDFIVCGGGTSGCVVASRLAEDPNAKVLVIEAGPHNENLENVHMVGGWSQNFDK
ETDWNVISTEGAGVNGRQVKLSRGKFLGGCSGCNGTLIVKGTKQDYDDWNLPGWSGDEFF
KYMRKAENFHSKPWFTESKDSHGHDGHLHTEPHDLAPISNLIRDSMVSKGLPLDHDMFSH
GNNPHGCGHSVRTVYSGLRTTGADFITKAKPKENLHLMVETHVDKVIIEKDENGDLKAAG
VRVVQADGTAIELKARKEVIVSGGAYCSPNILNRSGIGAKEELAKHGIDTLVDLPGVGKN
LQDHLIVFIFYETEKEGLTTDHLVYHGDAFTKSYAQWKEQKSGFLSTFPFGIFAFARLDE
RLADSEIWKSAPRKEGRDPMGLTSKQPHVEFFTTECYGGPKQFDQFPVDNKHAFSIIAEL
FAPKSRGSVTLRNSEATAVPVVDCNYLSDPLDLEVLAEACAFGNEIVMEGSGTKDIVKGA
WPPALTHHKYKTRDDWKEYVKNGATTCYHASGTCAAGKADDPKVVVDEKLRVRGVKNLRV
ADCSIMPTVNNGHTQMPAYGIGEKAADLIKEAWA

Enzyme Prediction     

No EC number prediction in EEU47403.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	6	571	1e-162	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	6.72e-91	7	570	6	532	choline dehydrogenase; Validated
225186	BetA	7.52e-91	1	572	2	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	9.44e-38	423	565	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	4.50e-27	70	306	6	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	3.45e-26	4	556	53	566	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK91457.1|AA3_2	0.0	1	574	1	574
QPC69645.1|AA3_2	0.0	3	574	4	575
CZS80033.1|AA3_2	0.0	3	574	4	575
CEF76742.1|AA3_2	0.0	3	574	4	575
QPC58252.1|AA3_2	0.0	3	574	4	575

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	3.15e-74	5	570	5	570	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	4.41e-74	5	570	5	570	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	6.16e-74	5	570	5	570	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
4H7U_A	2.49e-65	7	573	41	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	6.18e-64	7	570	2	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0R4L2|PDH3_LEUMG	1.39e-73	1	574	35	600	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q988C9|4PADH_RHILO	8.02e-72	1	569	1	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|P18172|DHGL_DROPS	9.95e-69	3	573	61	608	Glucose dehydrogenase [FAD, quinone] OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=Gld PE=3 SV=4
sp|Q3L243|PDH2_LEUMG	8.61e-67	7	573	41	599	Pyranose dehydrogenase 2 OS=Leucoagaricus meleagris OX=201219 GN=pdh2 PE=2 SV=1
sp|Q5B8A1|PKFF_EMENI	1.08e-66	4	571	38	609	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000001

TMHMM  Annotations     

There is no transmembrane helices in EEU47403.1.