CAZyme Information: EEU47162.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU47162.1
• CAZy Family: GT32
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:C7YKZ4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
847		93169.31	5.1779

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698897:179194-181876(-)

Full Sequence      

MFLINVENAIEQLTLDEKVKLLAGQDTWGTWANDRVGIPRITTSDGPHGVRGTSFFNGPR
GMLLPSATAMGATFDPELIHTAGELLAAEAKEKKCHVLLAPTVCIQRSPLLGRGFEAFAE
DPWLSGTIASAYVNGVQSHGVACAIKHFAAHDQSSMSVEDDVRASERTLREMHLLPFQLA
VKNASPWAFMMAYNKINGVHATENSWLMNQVLRQDWGWDGLVMSDWFGTYSTSESLNAGM
DLEMPGPSRWRGDLLGWAVMSDKVKKPTIDASVRNLLKLINKVQPWKDEAPKEVGDTQRK
RDLCRKVASEAIVLLKNERNILPLDSNKRQTYGLIGPAIGNPAISGGGSADLTPHYVSRP
LEAIIDVVGSENVKTAIGCQAHLFTPQLSKDISVPNSTEPGYLVSWFKEDPVLNPAAEPV
ASVTTVQAQMYFADNLPEAVPKTYWLQAKTIYTAPKSCTIQLGLCVLGKGKLFVDGQEKI
DLYTSQPEKTLQTPMFDQASMEVTAELEVQEGKQYEILVYLKNEAATAGVGALNCGGLRV
GCCEKIDPATALAEAVKLASEVDVPIVIAGLNSDFESEALDRKSLDLPPAVDKLITAVIK
ANKNTAIILTNFHQVVVTQSGCPILMPWLDDTPTLVHAWFGGQETGNAIADVLFGKTNPS
GRLSLTFPKRLEDTPAFLTFGKGEREIHYGEGVFVGYRYYEKLRNSPLFYFGFGLSYSQF
EYSNLQVPEKVNLFETDTFDVSVDVTNTSNRGGHEVVQLYVADKTSTAPRPLKELKAFKK
VWIDAAQSQKVTISLDKYALSFWSEIECKWLAEAGVFEVIIARSSDPKDELLRAEFELVK
NFTWNGV

Enzyme Prediction     

No EC number prediction in EEU47162.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	245	1.2e-65	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	7.27e-86	35	838	101	764	beta-glucosidase BglX.
224389	BglX	2.42e-68	35	374	57	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	8.98e-50	539	697	68	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.01e-46	32	279	60	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	7.15e-42	10	796	57	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96510.1|GH3	0.0	1	847	1	823
UPK92226.1|GH3	0.0	4	847	5	845
QKD58970.1|GH3	0.0	3	847	4	848
UPK98381.1|GH3	0.0	3	847	4	848
CEI68123.1|GH3	0.0	3	847	4	872

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	4.80e-185	5	847	5	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.05e-180	5	847	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.93e-128	4	846	3	682	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.68e-113	5	825	4	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	4.30e-92	6	825	4	702	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BA18|BGLK_EMENI	2.70e-209	5	847	12	838	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|A1DFA8|BGLI_NEOFI	3.83e-206	1	847	1	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|A1DNN8|BGLJ_NEOFI	1.22e-205	6	847	14	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	6.27e-205	4	847	4	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.21e-204	5	847	5	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.985098	0.014937

TMHMM  Annotations     

There is no transmembrane helices in EEU47162.1.