CAZyme Information: EEU46128.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU46128.1
• CAZy Family: GT20
• CAZyme Description: glycoside hydrolase family 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	GG698898|CGC1	55015.59	5.4948

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698898:2611497-2613003(+)

Full Sequence      

MSLPADFKWGFATASYQIEGSIHKDGRGVANWDVFCDKPGKIADGSSGVTACDSYNRTAE
DIALLKSVGAKAYRFSICWSRIIPLGGRNDPINQAGIDHYRKFVDDLLDAGITPFITLFH
WDVPHELDVRYGGLLNRTEFPLDYERYARVMFENIPRCKNWITHNEPWCSSILGYSTGSN
APGRCSDRTKSDVGDSSREPWIVGHNLLVAHGRAVKVYREEFKPKNGGEIGITLNGDATF
PWDPKDPRDVEAATRKIEFAISWFADPIYLGDYPASMRAQLGDRLPTFTPEEIALVKGSN
DFYGMNHYTANYVKHRDGEAPADDFLGNLELHFWNYRGDCIGPETQSTWLRPCAPGFRDL
LVWLSKRYGFPRMYVTENGTSIKGENDMPREKILEDDFRAQYYDDYVKAMADASRLDGVD
VHGYFAWSLLDNFEWAEGYETRFGVTYVDYEHDQKRYPKKSAQHLAPLFDSLIRKEDPKV
ESK

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	467	1.5e-150	0.9743589743589743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	6.17e-164	2	462	4	441	Glycosyl hydrolase family 1.
225343	BglB	3.52e-130	1	462	2	443	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	1.09e-96	2	462	27	473	beta-glucosidase
215455	PLN02849	1.74e-96	4	462	31	473	beta-glucosidase
184102	PRK13511	1.44e-93	2	462	4	456	6-phospho-beta-galactosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK89531.1|GH1	0.0	1	483	1	483
CEI39380.1|GH1	0.0	1	477	1	477
QPC64771.1|GH1	0.0	1	477	1	477
CEF83012.1|GH1	0.0	1	477	1	477
CZS73114.1|GH1	0.0	1	477	1	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	5.10e-294	1	476	24	499	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	5.60e-276	3	476	3	466	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	1.53e-273	1	476	1	466	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	1.26e-272	3	476	22	485	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	2.30e-272	3	473	9	470	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	3.13e-195	3	479	11	480	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	5.38e-177	3	473	6	460	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q7XKV4|BGL12_ORYSJ	7.94e-137	2	462	38	501	Beta-glucosidase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU12 PE=1 SV=2
sp|B8AVF0|BGL12_ORYSI	3.18e-136	2	462	38	501	Beta-glucosidase 12 OS=Oryza sativa subsp. indica OX=39946 GN=BGLU12 PE=3 SV=1
sp|Q9M1D0|BGL16_ARATH	1.45e-135	4	469	36	500	Beta-glucosidase 16 OS=Arabidopsis thaliana OX=3702 GN=BGLU16 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000005

TMHMM  Annotations     

There is no transmembrane helices in EEU46128.1.